BLASTX nr result
ID: Scutellaria22_contig00012626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012626 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET22503.1| hypothetical protein [Solanum lycopersicum] 52 1e-10 gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|35... 51 2e-10 >gb|AET22503.1| hypothetical protein [Solanum lycopersicum] Length = 888 Score = 51.6 bits (122), Expect(2) = 1e-10 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 274 LKYLSIEDTDLVRWKRTFL-ALNFKELKHLSIKHCYELEELPNNF--IPCVEKIQVVDCS 444 LKYL +E DLV WK+ + F L+HL + C +L+E+P IP ++ I++ CS Sbjct: 799 LKYLLVESRDLVVWKQASTDSYPFPALQHLVFRFCNKLKEIPYEIGDIPSLQVIELYSCS 858 Query: 445 PYAVSWAKKI 474 PYA A+ I Sbjct: 859 PYATRLARMI 868 Score = 38.9 bits (89), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 66 FPPGLKKLSLSGLQCSWENMSVIGKLRNLQVLKLR 170 FPP LK L+LS W++ V+G L NL+VLKL+ Sbjct: 746 FPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLK 780 >gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|356600308|gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium] Length = 886 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 274 LKYLSIEDTDLVRWKRTFL-ALNFKELKHLSIKHCYELEELPNNF--IPCVEKIQVVDCS 444 LKYL +E DLV WK+ + F L+HL + C +L+E+P IP ++ I++ CS Sbjct: 797 LKYLLVESRDLVIWKQASTDSYPFPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYSCS 856 Query: 445 PYAVSWAKKI 474 PYA A+ I Sbjct: 857 PYATRLARMI 866 Score = 38.9 bits (89), Expect(2) = 2e-10 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 66 FPPGLKKLSLSGLQCSWENMSVIGKLRNLQVLKLR 170 FPP LK L+LS W++ V+G L NL+VLKL+ Sbjct: 744 FPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLK 778