BLASTX nr result
ID: Scutellaria22_contig00012523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012523 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534318.1| PREDICTED: ATP-dependent Clp protease proteo... 55 5e-06 ref|XP_003517082.1| PREDICTED: ATP-dependent Clp protease proteo... 55 5e-06 >ref|XP_003534318.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 4, chloroplastic-like [Glycine max] Length = 306 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 430 MPVPERVKASNFDYVEISKDRKKFLTPEIPDDEIY 326 MPVPERVK S +Y EISKD +KFLTP+IPDDEIY Sbjct: 273 MPVPERVK-STLNYEEISKDPRKFLTPDIPDDEIY 306 >ref|XP_003517082.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 4, chloroplastic-like [Glycine max] Length = 306 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 430 MPVPERVKASNFDYVEISKDRKKFLTPEIPDDEIY 326 MPVPERVK S +Y EISKD +KFLTP+IPDDEIY Sbjct: 273 MPVPERVK-STLNYEEISKDPRKFLTPDIPDDEIY 306