BLASTX nr result
ID: Scutellaria22_contig00012355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012355 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29559.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_002534076.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_003546981.1| PREDICTED: uncharacterized protein LOC100804... 57 2e-06 ref|XP_003542063.1| PREDICTED: uncharacterized protein LOC100811... 57 2e-06 >emb|CBI29559.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 152 MSFDGGEKQWKCVKGGPVNFLKVSSIVRDIGEPCLHQSPIK 274 MS++ +KQW C K +N KVS+IVRDIGEPCLHQSPIK Sbjct: 1 MSYEKEDKQWSCGKASSMNLQKVSAIVRDIGEPCLHQSPIK 41 >ref|XP_002534076.1| conserved hypothetical protein [Ricinus communis] gi|223525888|gb|EEF28308.1| conserved hypothetical protein [Ricinus communis] Length = 662 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +2 Query: 152 MSFDGGE-KQWKCVKGGPVNFLKVSSIVRDIGEPCLHQSPIK 274 MS GGE KQW C K G VN +V SIVRDIGEPCL QSPIK Sbjct: 1 MSCGGGEEKQWSCGKPGAVNLQRVGSIVRDIGEPCLAQSPIK 42 >ref|XP_003546981.1| PREDICTED: uncharacterized protein LOC100804956 [Glycine max] Length = 699 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +2 Query: 170 EKQWKCVKGGPVNFLKVSSIVRDIGEPCLHQSPIK 274 EKQW C K G N KVSSIVRDIG+PCL QSP+K Sbjct: 7 EKQWTCGKAGAANLRKVSSIVRDIGDPCLSQSPVK 41 >ref|XP_003542063.1| PREDICTED: uncharacterized protein LOC100811679 [Glycine max] Length = 706 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 173 KQWKCVKGGPVNFLKVSSIVRDIGEPCLHQSPIK 274 KQW C K G VN KVSSIVRDIG+PCL QSP+K Sbjct: 8 KQWSCGKAGAVNLRKVSSIVRDIGDPCLSQSPVK 41