BLASTX nr result
ID: Scutellaria22_contig00012203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012203 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332553.1| cc-nbs-lrr resistance protein [Populus trich... 82 3e-14 ref|XP_002333000.1| nbs-lrr resistance protein [Populus trichoca... 80 2e-13 ref|XP_002320669.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 ref|XP_002328104.1| cc-nbs-lrr resistance protein [Populus trich... 77 1e-12 ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trich... 77 1e-12 >ref|XP_002332553.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222833029|gb|EEE71506.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1185 Score = 82.4 bits (202), Expect = 3e-14 Identities = 45/81 (55%), Positives = 56/81 (69%), Gaps = 2/81 (2%) Frame = +2 Query: 116 FKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRVDN--E 289 FKSL TL + + + ELS SI KLVHLRYLDVS T I LP+SI LYHLQTLR + Sbjct: 562 FKSLRTLKLQNSDITELSDSICKLVHLRYLDVSDTAIRALPESIRKLYHLQTLRFTDCKS 621 Query: 290 MSKLPTTVQYLINLRHLHLSE 352 + KLP ++ L++LRHLH + Sbjct: 622 LEKLPKKMRNLVSLRHLHFDD 642 >ref|XP_002333000.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222834485|gb|EEE72962.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 963 Score = 80.1 bits (196), Expect = 2e-13 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 2/81 (2%) Frame = +2 Query: 113 NFKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRV--DN 286 NFKSL TL + + EL SI KL HLRYLDVS T I+ LPDSI +LY+LQTLR+ Sbjct: 544 NFKSLRTLSLDGADIRELQGSIGKLKHLRYLDVSRTHITALPDSITNLYNLQTLRLVECR 603 Query: 287 EMSKLPTTVQYLINLRHLHLS 349 + LP ++ L+NLRH+H++ Sbjct: 604 SLQALPRRMRDLVNLRHIHVT 624 >ref|XP_002320669.1| predicted protein [Populus trichocarpa] gi|222861442|gb|EEE98984.1| predicted protein [Populus trichocarpa] Length = 914 Score = 79.0 bits (193), Expect = 4e-13 Identities = 44/81 (54%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +2 Query: 116 FKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRVD--NE 289 FKSL TL + + EL SI KL HLRYLDVS T I LP+SI LYHL+TLR N Sbjct: 116 FKSLRTLKLKKSDIIELPDSIYKLRHLRYLDVSDTAIRALPESITKLYHLETLRFTDCNS 175 Query: 290 MSKLPTTVQYLINLRHLHLSE 352 + KLP ++ L++LRHLH S+ Sbjct: 176 LEKLPKKMRNLVSLRHLHFSD 196 Score = 79.0 bits (193), Expect = 4e-13 Identities = 44/81 (54%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +2 Query: 116 FKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRVD--NE 289 FKSL TL + + EL SI KL HLRYLDVS T I LP+SI LYHL+TLR N Sbjct: 298 FKSLRTLKLKKSDIIELPDSIYKLRHLRYLDVSDTAIRALPESITKLYHLETLRFTDCNS 357 Query: 290 MSKLPTTVQYLINLRHLHLSE 352 + KLP ++ L++LRHLH S+ Sbjct: 358 LEKLPKKMRNLVSLRHLHFSD 378 >ref|XP_002328104.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222837619|gb|EEE75984.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1141 Score = 77.4 bits (189), Expect = 1e-12 Identities = 41/80 (51%), Positives = 55/80 (68%), Gaps = 2/80 (2%) Frame = +2 Query: 116 FKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRVDN--E 289 F+ L +LI+ D ++ EL SI +L HLRYLDVS T+I LP SI LYHLQTLR + Sbjct: 520 FRGLRSLILNDARMTELPDSICRLKHLRYLDVSRTDIKALPKSITKLYHLQTLRFSDCRS 579 Query: 290 MSKLPTTVQYLINLRHLHLS 349 + KLP ++YL++LRH+ S Sbjct: 580 LIKLPNKMEYLVSLRHIDFS 599 >ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|105922514|gb|ABF81421.1| NBS-LRR type disease resistance protein [Populus trichocarpa] gi|222836549|gb|EEE74956.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1177 Score = 77.4 bits (189), Expect = 1e-12 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +2 Query: 116 FKSLHTLIVLDEKVEELSASINKLVHLRYLDVSPTEISYLPDSIGDLYHLQTLRVDNEMS 295 FKSL TL + V EL SI KL HLRYLDVS T I LP+SI LYHL+TLR + MS Sbjct: 556 FKSLRTLKLQRSDVTELPGSICKLRHLRYLDVSCTRIRELPESITKLYHLETLRFTDCMS 615 Query: 296 --KLPTTVQYLINLRHLHLSE 352 KLP ++ L++LRHLH + Sbjct: 616 LQKLPKKMRNLVSLRHLHFDD 636