BLASTX nr result
ID: Scutellaria22_contig00012064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012064 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139635.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-... 61 1e-07 gb|AAM64697.1| PRT1 [Arabidopsis thaliana] 61 1e-07 ref|NP_189124.1| E3 ubiquitin-protein ligase PRT1 [Arabidopsis t... 61 1e-07 ref|XP_002883562.1| hypothetical protein ARALYDRAFT_479998 [Arab... 61 1e-07 emb|CBI37313.3| unnamed protein product [Vitis vinifera] 60 2e-07 >ref|XP_004139635.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Cucumis sativus] Length = 359 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 4/51 (7%) Frame = -2 Query: 302 IDASNFV----LAFTHFPCFAACGHISCFWCVFKAMDTFQESHCPVCRNLY 162 +DA F+ L + P CGHISCFWCV K M+ F+ESHCP+CR Y Sbjct: 10 VDADAFLCCVCLDLLYKPIVLPCGHISCFWCVHKCMNGFRESHCPICRRSY 60 >gb|AAM64697.1| PRT1 [Arabidopsis thaliana] Length = 401 Score = 60.8 bits (146), Expect = 1e-07 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 281 LAFTHFPCFAACGHISCFWCVFKAMDTFQESHCPVCRNLYM 159 L + P +CGH+SCFWCV K+M+ F+ESHCP+CR+ Y+ Sbjct: 21 LELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYV 61 >ref|NP_189124.1| E3 ubiquitin-protein ligase PRT1 [Arabidopsis thaliana] gi|62900696|sp|Q8LBL5.2|PRT1_ARATH RecName: Full=E3 ubiquitin-protein ligase PRT1; AltName: Full=Proteolysis 1 protein gi|3319884|emb|CAA11891.1| PRT1 [Arabidopsis thaliana] gi|3319886|emb|CAA11892.1| PRT1 [Arabidopsis thaliana] gi|11994662|dbj|BAB02890.1| PRT1 protein [Arabidopsis thaliana] gi|19424005|gb|AAL87280.1| putative PRT1 protein [Arabidopsis thaliana] gi|21280981|gb|AAM45125.1| putative PRT1 protein [Arabidopsis thaliana] gi|332643427|gb|AEE76948.1| E3 ubiquitin-protein ligase PRT1 [Arabidopsis thaliana] Length = 410 Score = 60.8 bits (146), Expect = 1e-07 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 281 LAFTHFPCFAACGHISCFWCVFKAMDTFQESHCPVCRNLYM 159 L + P +CGH+SCFWCV K+M+ F+ESHCP+CR+ Y+ Sbjct: 30 LELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYV 70 >ref|XP_002883562.1| hypothetical protein ARALYDRAFT_479998 [Arabidopsis lyrata subsp. lyrata] gi|297329402|gb|EFH59821.1| hypothetical protein ARALYDRAFT_479998 [Arabidopsis lyrata subsp. lyrata] Length = 417 Score = 60.8 bits (146), Expect = 1e-07 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 281 LAFTHFPCFAACGHISCFWCVFKAMDTFQESHCPVCRNLYM 159 L + P +CGH+SCFWCV K+M+ F+ESHCP+CR+ Y+ Sbjct: 30 LELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYV 70 >emb|CBI37313.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -2 Query: 263 PCFAACGHISCFWCVFKAMDTFQESHCPVCRNLY 162 P ACGHISCFWCV +MD ESHCP+CRN Y Sbjct: 15 PIVLACGHISCFWCVHYSMDGAHESHCPICRNPY 48