BLASTX nr result
ID: Scutellaria22_contig00012054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012054 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ43709.1| glutathion peroxidase [Plantago major] 77 2e-12 ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [S... 76 3e-12 ref|NP_001141210.1| uncharacterized protein LOC100273297 [Zea ma... 76 3e-12 gb|AAS82602.1| putative glutathione peroxidase [Zea mays] gi|413... 76 3e-12 gb|AAA76742.1| putative ORF1, partial [Avena fatua] 76 3e-12 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 KWNFSKFLIDKEGRVVDRYAPTTSPLSIEKDIKKLLEQ 114 KWNFSKFL+DKEG+VVDRYAPTTSPLSIEKD+KKLLE+ Sbjct: 130 KWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLEK 167 >ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [Sorghum bicolor] gi|48374968|gb|AAT42166.1| putative glutathione peroxidase [Sorghum bicolor] gi|241938104|gb|EES11249.1| hypothetical protein SORBIDRAFT_06g024920 [Sorghum bicolor] Length = 168 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 KWNFSKFLIDKEGRVVDRYAPTTSPLSIEKDIKKLL 108 KWNFSKFL+DKEGRVVDRYAPTTSPLSIEKDIKKLL Sbjct: 130 KWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLL 165 >ref|NP_001141210.1| uncharacterized protein LOC100273297 [Zea mays] gi|48374955|gb|AAT42154.1| putative glutathione peroxidase [Zea mays] gi|194703274|gb|ACF85721.1| unknown [Zea mays] gi|195622840|gb|ACG33250.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] gi|223975959|gb|ACN32167.1| unknown [Zea mays] gi|414585925|tpg|DAA36496.1| TPA: glutathione peroxidase isoform 1 [Zea mays] gi|414585926|tpg|DAA36497.1| TPA: glutathione peroxidase isoform 2 [Zea mays] Length = 168 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 KWNFSKFLIDKEGRVVDRYAPTTSPLSIEKDIKKLL 108 KWNFSKFL+DKEGRVVDRYAPTTSPLSIEKDIKKLL Sbjct: 130 KWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLL 165 >gb|AAS82602.1| putative glutathione peroxidase [Zea mays] gi|413919298|gb|AFW59230.1| glutathione peroxidase [Zea mays] Length = 176 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 KWNFSKFLIDKEGRVVDRYAPTTSPLSIEKDIKKLL 108 KWNFSKFL+DKEGRVVDRYAPTTSPLSIEKDIKKLL Sbjct: 138 KWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLL 173 >gb|AAA76742.1| putative ORF1, partial [Avena fatua] Length = 116 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 KWNFSKFLIDKEGRVVDRYAPTTSPLSIEKDIKKLL 108 KWNFSKFL+DKEGRVVDRYAPTTSPLSIEKDIKKLL Sbjct: 78 KWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLL 113