BLASTX nr result
ID: Scutellaria22_contig00011655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00011655 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31974.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002275251.1| PREDICTED: cullin-3A [Vitis vinifera] 62 6e-08 emb|CAN81888.1| hypothetical protein VITISV_021501 [Vitis vinifera] 62 6e-08 ref|XP_004147468.1| PREDICTED: cullin-3A-like [Cucumis sativus] ... 61 1e-07 emb|CBI22194.3| unnamed protein product [Vitis vinifera] 61 1e-07 >emb|CBI31974.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 322 GGPKKRNFQIEAFKHKVVVDPKYAEKTWKIL 414 G KKRNFQIEAFKH+VVVDPKYA+KTWKIL Sbjct: 2 GSQKKRNFQIEAFKHRVVVDPKYADKTWKIL 32 >ref|XP_002275251.1| PREDICTED: cullin-3A [Vitis vinifera] Length = 733 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 322 GGPKKRNFQIEAFKHKVVVDPKYAEKTWKIL 414 G KKRNFQIEAFKH+VVVDPKYA+KTWKIL Sbjct: 2 GSQKKRNFQIEAFKHRVVVDPKYADKTWKIL 32 >emb|CAN81888.1| hypothetical protein VITISV_021501 [Vitis vinifera] Length = 718 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 322 GGPKKRNFQIEAFKHKVVVDPKYAEKTWKIL 414 G KKRNFQIEAFKH+VVVDPKYA+KTWKIL Sbjct: 2 GSQKKRNFQIEAFKHRVVVDPKYADKTWKIL 32 >ref|XP_004147468.1| PREDICTED: cullin-3A-like [Cucumis sativus] gi|449509229|ref|XP_004163530.1| PREDICTED: cullin-3A-like [Cucumis sativus] Length = 733 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 331 KKRNFQIEAFKHKVVVDPKYAEKTWKIL 414 KKRNFQIEAFKH+VVVDPKYAEKTWKIL Sbjct: 5 KKRNFQIEAFKHRVVVDPKYAEKTWKIL 32 >emb|CBI22194.3| unnamed protein product [Vitis vinifera] Length = 724 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 331 KKRNFQIEAFKHKVVVDPKYAEKTWKIL 414 KKRNFQIEAFKH+VVVDPKYAEKTWKIL Sbjct: 5 KKRNFQIEAFKHRVVVDPKYAEKTWKIL 32