BLASTX nr result
ID: Scutellaria22_contig00011346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00011346 (735 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524291.1| transcription factor, putative [Ricinus comm... 77 4e-12 ref|XP_002307500.1| predicted protein [Populus trichocarpa] gi|2... 77 4e-12 ref|XP_002300915.1| predicted protein [Populus trichocarpa] gi|2... 77 4e-12 emb|CAQ53097.1| basic-leucine zipper [Humulus lupulus] 77 4e-12 ref|XP_004160311.1| PREDICTED: G-box-binding factor 4-like [Cucu... 76 8e-12 >ref|XP_002524291.1| transcription factor, putative [Ricinus communis] gi|223536382|gb|EEF38031.1| transcription factor, putative [Ricinus communis] Length = 299 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 695 EPLDKAAQQRQKRMIKNRESAARSRERKQAYQLELESMAVR 573 EPLDKAAQQRQ+RMIKNRESAARSRERKQAYQ+ELES+AVR Sbjct: 236 EPLDKAAQQRQRRMIKNRESAARSRERKQAYQVELESLAVR 276 >ref|XP_002307500.1| predicted protein [Populus trichocarpa] gi|222856949|gb|EEE94496.1| predicted protein [Populus trichocarpa] Length = 314 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 695 EPLDKAAQQRQKRMIKNRESAARSRERKQAYQLELESMAVR 573 EPLDKAAQQRQ+RMIKNRESAARSRERKQAYQ+ELES+AVR Sbjct: 226 EPLDKAAQQRQRRMIKNRESAARSRERKQAYQVELESLAVR 266 >ref|XP_002300915.1| predicted protein [Populus trichocarpa] gi|222842641|gb|EEE80188.1| predicted protein [Populus trichocarpa] Length = 305 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 695 EPLDKAAQQRQKRMIKNRESAARSRERKQAYQLELESMAVR 573 EPLDKAAQQRQ+RMIKNRESAARSRERKQAYQ+ELES+AVR Sbjct: 226 EPLDKAAQQRQRRMIKNRESAARSRERKQAYQVELESLAVR 266 >emb|CAQ53097.1| basic-leucine zipper [Humulus lupulus] Length = 314 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 695 EPLDKAAQQRQKRMIKNRESAARSRERKQAYQLELESMAVR 573 EPLDKAAQQRQ+RMIKNRESAARSRERKQAYQ+ELES+AVR Sbjct: 226 EPLDKAAQQRQRRMIKNRESAARSRERKQAYQVELESLAVR 266 >ref|XP_004160311.1| PREDICTED: G-box-binding factor 4-like [Cucumis sativus] Length = 301 Score = 75.9 bits (185), Expect = 8e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 695 EPLDKAAQQRQKRMIKNRESAARSRERKQAYQLELESMAVR 573 EPLDKAA+QRQ+RMIKNRESAARSRERKQAYQ+ELES+AVR Sbjct: 213 EPLDKAAEQRQRRMIKNRESAARSRERKQAYQVELESLAVR 253