BLASTX nr result
ID: Scutellaria22_contig00011251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00011251 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138579.1| PREDICTED: uncharacterized protein LOC101220... 60 2e-07 gb|ADN34070.1| aspartic proteinase nepenthesin-1 precursor [Cucu... 60 2e-07 ref|XP_003518386.1| PREDICTED: aspartic proteinase nepenthesin-2... 56 3e-06 emb|CBI31649.3| unnamed protein product [Vitis vinifera] 54 1e-05 ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2... 54 1e-05 >ref|XP_004138579.1| PREDICTED: uncharacterized protein LOC101220661 [Cucumis sativus] Length = 2819 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 93 NRLSFHHNVTLTVSVAVGSPPQQATMVLDTG 1 N+LSFHHNVTLTVS+ VGSPPQQ TMVLDTG Sbjct: 990 NKLSFHHNVTLTVSLTVGSPPQQVTMVLDTG 1020 >gb|ADN34070.1| aspartic proteinase nepenthesin-1 precursor [Cucumis melo subsp. melo] Length = 412 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 93 NRLSFHHNVTLTVSVAVGSPPQQATMVLDTG 1 N+LSFHHNVTLTVS+ VGSPPQQ TMVLDTG Sbjct: 30 NKLSFHHNVTLTVSLTVGSPPQQVTMVLDTG 60 >ref|XP_003518386.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 428 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 90 RLSFHHNVTLTVSVAVGSPPQQATMVLDTG 1 +LSFHHNVTLTVS+ VGSPPQ TMVLDTG Sbjct: 51 KLSFHHNVTLTVSLTVGSPPQNVTMVLDTG 80 >emb|CBI31649.3| unnamed protein product [Vitis vinifera] Length = 761 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 93 NRLSFHHNVTLTVSVAVGSPPQQATMVLDTG 1 ++LSFHHNV+LTVS+ VGSPPQ TMVLDTG Sbjct: 365 SKLSFHHNVSLTVSLTVGSPPQTVTMVLDTG 395 >ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 436 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 93 NRLSFHHNVTLTVSVAVGSPPQQATMVLDTG 1 ++LSFHHNV+LTVS+ VGSPPQ TMVLDTG Sbjct: 53 SKLSFHHNVSLTVSLTVGSPPQTVTMVLDTG 83