BLASTX nr result
ID: Scutellaria22_contig00011195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00011195 (590 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888810.1| hypothetical protein ARALYDRAFT_476228 [Arab... 57 2e-06 ref|NP_565006.1| hydroxyproline-rich glycoprotein family protein... 55 7e-06 >ref|XP_002888810.1| hypothetical protein ARALYDRAFT_476228 [Arabidopsis lyrata subsp. lyrata] gi|297334651|gb|EFH65069.1| hypothetical protein ARALYDRAFT_476228 [Arabidopsis lyrata subsp. lyrata] Length = 135 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 274 PAPNFYGGSQ-------PPPEPILSWFPYYYRKPPHQ-DQSLSTV 164 P+P +YGGS PPP+PIL +FP+YYRKPPHQ DQS S+V Sbjct: 70 PSPPYYGGSPGGGYNGPPPPDPILPYFPFYYRKPPHQTDQSSSSV 114 >ref|NP_565006.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|21536546|gb|AAM60878.1| unknown [Arabidopsis thaliana] gi|332197026|gb|AEE35147.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] Length = 135 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 7/58 (12%) Frame = -2 Query: 274 PAPNFYGGSQ-------PPPEPILSWFPYYYRKPPHQDQSLSTVVKGSRTAVFIFPIL 122 P+P +YGG+ PPP+PIL +FP+YYRKPPHQ S+ +K + V + +L Sbjct: 70 PSPPYYGGNPSGGYNGPPPPDPILPYFPFYYRKPPHQTDQSSSSMKSTVKIVTVANLL 127