BLASTX nr result
ID: Scutellaria22_contig00011118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00011118 (1896 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527052.1| conserved hypothetical protein [Ricinus comm... 71 9e-10 >ref|XP_002527052.1| conserved hypothetical protein [Ricinus communis] gi|223533614|gb|EEF35352.1| conserved hypothetical protein [Ricinus communis] Length = 170 Score = 71.2 bits (173), Expect = 9e-10 Identities = 42/128 (32%), Positives = 71/128 (55%), Gaps = 3/128 (2%) Frame = +1 Query: 301 WTSQSSYDPSKSRDIHLHDRALLYIHRLLAFSFSGRKDSAAILSKAELFFLWCMKENKRV 480 W S + P ++ + D L +I+R A++ R DS I+ K E+FF+ CM++N +V Sbjct: 9 WLSVTMGTPKVAKSTSIIDPNLRHIYRWKAYTICARGDSFGIVQKTEVFFMHCMQKNIKV 68 Query: 481 NFGYWLASQISRVNVD-NKNLILGSLITMLAVNLNKFDPENNDLHIACVTSP--LDLVSL 651 G +LAS + + N+N+++ SL+T +A L FDP++ + + L+L +L Sbjct: 69 ALGRFLASHLQSITTQPNENILIRSLVTKIATYLKVFDPKDITFKLLPQSDAEVLNLHTL 128 Query: 652 EKMHLISK 675 KM LI K Sbjct: 129 VKMELIKK 136