BLASTX nr result
ID: Scutellaria22_contig00009809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00009809 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002894528.1| invertase/pectin methylesterase inhibitor fa... 55 8e-06 >ref|XP_002894528.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] gi|297340370|gb|EFH70787.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] Length = 175 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/107 (31%), Positives = 54/107 (50%) Frame = -2 Query: 433 HAENITTRIKKVSAVPDVAPLLQSALTDCMDQYNSLDDVIEDAINAVQASAYADAQKFIT 254 +A ++ IKK + D+ P ++ L DC Y + ++D+I+A+ A A+AD ++ Sbjct: 71 NASATSSYIKKKLSNEDLEPAIEDTLEDCQKNYQDAVEQLDDSISAMLADAHADVDVWLR 130 Query: 253 AAISSIDLCDSQLNVSNLDEVKYSRTKEDVELESGLKKYNVFHKNLL 113 AAIS+I+ C S L+ SR D EL K + KN L Sbjct: 131 AAISAIESCGSALD---------SRAGNDAELSQRNKVFLKLCKNAL 168