BLASTX nr result
ID: Scutellaria22_contig00009519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00009519 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEH05973.1| elicitor-responsive protein [Hevea brasiliensis] 67 2e-09 gb|AET97660.1| elicitor responsive protein 3 [Camellia sinensis] 66 3e-09 ref|XP_002282926.1| PREDICTED: elicitor-responsive protein 3 [Vi... 64 1e-08 ref|XP_003580201.1| PREDICTED: elicitor-responsive protein 3-lik... 64 2e-08 ref|XP_003524467.1| PREDICTED: elicitor-responsive protein 3-lik... 64 2e-08 >gb|AEH05973.1| elicitor-responsive protein [Hevea brasiliensis] Length = 140 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 87 MPYGTLEVLLVCAKGLDNTDFLSGVDPYAILICKTQEKKS 206 MP GT+EVLLV AKGL+NTDFL+GVDPY +L C+TQE+KS Sbjct: 1 MPLGTVEVLLVGAKGLENTDFLNGVDPYVVLACRTQEQKS 40 >gb|AET97660.1| elicitor responsive protein 3 [Camellia sinensis] Length = 147 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 87 MPYGTLEVLLVCAKGLDNTDFLSGVDPYAILICKTQEKKS 206 MP GTLEVLLV AKGL+NTDFLS +DPY IL C+TQE+KS Sbjct: 1 MPRGTLEVLLVGAKGLENTDFLSNMDPYVILTCRTQEQKS 40 >ref|XP_002282926.1| PREDICTED: elicitor-responsive protein 3 [Vitis vinifera] gi|297742592|emb|CBI34741.3| unnamed protein product [Vitis vinifera] Length = 147 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 87 MPYGTLEVLLVCAKGLDNTDFLSGVDPYAILICKTQEKKS 206 MP GTLEVLLV AKGL+NTDFL +DPY +L C+TQE+KS Sbjct: 1 MPQGTLEVLLVGAKGLENTDFLCNMDPYVVLTCRTQEQKS 40 >ref|XP_003580201.1| PREDICTED: elicitor-responsive protein 3-like [Brachypodium distachyon] Length = 131 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 87 MPYGTLEVLLVCAKGLDNTDFLSGVDPYAILICKTQEKKS 206 M GTLEVLLV AKGL+NTDFLS +DPYA+LIC +QE+KS Sbjct: 1 MAQGTLEVLLVGAKGLENTDFLSNMDPYAVLICTSQEQKS 40 >ref|XP_003524467.1| PREDICTED: elicitor-responsive protein 3-like [Glycine max] Length = 146 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 87 MPYGTLEVLLVCAKGLDNTDFLSGVDPYAILICKTQEKKS 206 MP G+LEV LV AKGLDNTD+L +DPY ILIC+TQE+KS Sbjct: 1 MPQGSLEVFLVNAKGLDNTDYLCNMDPYVILICRTQEQKS 40