BLASTX nr result
ID: Scutellaria22_contig00009467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00009467 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512090.1| pentatricopeptide repeat-containing protein,... 86 4e-15 ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_002893403.1| pentatricopeptide repeat-containing protein ... 77 2e-12 ref|NP_564247.1| pentatricopeptide repeat-containing protein [Ar... 75 7e-12 gb|AAM61409.1| unknown [Arabidopsis thaliana] 75 7e-12 >ref|XP_002512090.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549270|gb|EEF50759.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/77 (54%), Positives = 54/77 (70%) Frame = +2 Query: 2 PNPASGSSLYHDNWRSSTFSDSPSPDAATIPYSLGFLRLNNDAQMQSLSQMLDANGLMDQ 181 PNPASGS LYH+NWR+ T +P A IP+ G L A+ QS+SQ LD N L++ Sbjct: 57 PNPASGSPLYHENWRNPTLIQNPD---ALIPF--GILHQPPTARFQSMSQTLDLNSLLNL 111 Query: 182 FAEWMTSRRWADVKQLF 232 FA+WMTS+RW+D+KQLF Sbjct: 112 FADWMTSQRWSDMKQLF 128 >ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Vitis vinifera] gi|297738080|emb|CBI27281.3| unnamed protein product [Vitis vinifera] Length = 616 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/77 (54%), Positives = 55/77 (71%) Frame = +2 Query: 2 PNPASGSSLYHDNWRSSTFSDSPSPDAATIPYSLGFLRLNNDAQMQSLSQMLDANGLMDQ 181 PNPASGS LY++NWRS P P A +I LGFL ++ +++Q+LSQ LD LM+ Sbjct: 57 PNPASGSPLYNENWRS------PIPQAQSI-IPLGFLHQSSSSRLQALSQTLDVPSLMNV 109 Query: 182 FAEWMTSRRWADVKQLF 232 FA+WMTS+RWAD+ QLF Sbjct: 110 FADWMTSQRWADMNQLF 126 >ref|XP_002893403.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339245|gb|EFH69662.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 630 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/77 (48%), Positives = 55/77 (71%) Frame = +2 Query: 2 PNPASGSSLYHDNWRSSTFSDSPSPDAATIPYSLGFLRLNNDAQMQSLSQMLDANGLMDQ 181 PNPA+GS LY +NWRS ++PS + + +P LGFL A++++LS+ LD N L++ Sbjct: 64 PNPATGSPLYQENWRSP-IPNTPSFNQSLVP--LGFLNQAPAARIRALSETLDMNSLLNM 120 Query: 182 FAEWMTSRRWADVKQLF 232 FA+W S+RW+D+KQLF Sbjct: 121 FADWTASQRWSDMKQLF 137 >ref|NP_564247.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75173405|sp|Q9FZD1.1|PPR58_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g26460, mitochondrial; Flags: Precursor gi|9797754|gb|AAF98572.1|AC013427_15 Contains similarity to a hypothetical protein F21B7.16 gi|7485908 from Arabidopsis thaliana BAC F21B7 gb|AC002560 and contains multiple PPR PF|01535 repeats and a domain of unknown function PF|00668. ESTs gb|T45755, gb|AI993167, gb|AV554476, gb|T46823, gb|T41981, gb|AV546597, gb|AI099868 come from this gene [Arabidopsis thaliana] gi|19698979|gb|AAL91225.1| unknown protein [Arabidopsis thaliana] gi|22136300|gb|AAM91228.1| unknown protein [Arabidopsis thaliana] gi|332192573|gb|AEE30694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 630 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/77 (46%), Positives = 54/77 (70%) Frame = +2 Query: 2 PNPASGSSLYHDNWRSSTFSDSPSPDAATIPYSLGFLRLNNDAQMQSLSQMLDANGLMDQ 181 PNPA+GS LY +NWRS ++PS + + +P LGFL ++++LS+ LD N L++ Sbjct: 64 PNPATGSPLYQENWRSP-IPNTPSFNQSLVP--LGFLNQAPAPRIRALSETLDMNSLLNM 120 Query: 182 FAEWMTSRRWADVKQLF 232 FA+W S+RW+D+KQLF Sbjct: 121 FADWTASQRWSDMKQLF 137 >gb|AAM61409.1| unknown [Arabidopsis thaliana] Length = 630 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/77 (46%), Positives = 54/77 (70%) Frame = +2 Query: 2 PNPASGSSLYHDNWRSSTFSDSPSPDAATIPYSLGFLRLNNDAQMQSLSQMLDANGLMDQ 181 PNPA+GS LY +NWRS ++PS + + +P LGFL ++++LS+ LD N L++ Sbjct: 64 PNPATGSPLYQENWRSP-IPNTPSFNQSLVP--LGFLNQAPAPRIRALSETLDMNSLLNM 120 Query: 182 FAEWMTSRRWADVKQLF 232 FA+W S+RW+D+KQLF Sbjct: 121 FADWTASQRWSDMKQLF 137