BLASTX nr result
ID: Scutellaria22_contig00009199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00009199 (2204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144741.1| PREDICTED: trafficking protein particle comp... 54 3e-09 ref|XP_003630811.1| Trafficking protein particle complex subunit... 54 4e-09 gb|AFK42150.1| unknown [Medicago truncatula] 54 5e-09 ref|NP_195848.1| SNARE-like superfamily protein [Arabidopsis tha... 49 4e-08 ref|XP_003616027.1| Trafficking protein particle complex subunit... 47 5e-07 >ref|XP_004144741.1| PREDICTED: trafficking protein particle complex subunit 4-like [Cucumis sativus] gi|449490796|ref|XP_004158709.1| PREDICTED: trafficking protein particle complex subunit 4-like [Cucumis sativus] Length = 141 Score = 53.5 bits (127), Expect(3) = 3e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 1608 YIMQMPIRCELFDINLARAVQRDQVSLLGR 1519 Y M+MPIRCELFDINLA+AVQ+D+V+LLGR Sbjct: 112 YEMEMPIRCELFDINLAQAVQKDRVALLGR 141 Score = 35.4 bits (80), Expect(3) = 3e-09 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 2/22 (9%) Frame = -1 Query: 1724 GTKFFVVCEPGT--LQNFLKYI 1665 GTKFFVVCEPGT +++ LKYI Sbjct: 77 GTKFFVVCEPGTQHMESLLKYI 98 Score = 20.4 bits (41), Expect(3) = 3e-09 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 1669 IYELYTDY 1646 IYELYTD+ Sbjct: 98 IYELYTDF 105 >ref|XP_003630811.1| Trafficking protein particle complex subunit [Medicago truncatula] gi|355524833|gb|AET05287.1| Trafficking protein particle complex subunit [Medicago truncatula] Length = 213 Score = 53.5 bits (127), Expect(3) = 4e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 1608 YIMQMPIRCELFDINLARAVQRDQVSLLGR 1519 Y M+MPIRCELFDINLA+AVQ+D+V+LLGR Sbjct: 184 YEMEMPIRCELFDINLAQAVQKDRVALLGR 213 Score = 33.5 bits (75), Expect(3) = 4e-09 Identities = 14/22 (63%), Positives = 19/22 (86%), Gaps = 2/22 (9%) Frame = -1 Query: 1724 GTKFFVVCEPGT--LQNFLKYI 1665 GTKFFVVCEPGT +++ LK++ Sbjct: 149 GTKFFVVCEPGTQQMESLLKFV 170 Score = 21.6 bits (44), Expect(3) = 4e-09 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 1669 IYELYTDY 1646 +YELYTDY Sbjct: 170 VYELYTDY 177 >gb|AFK42150.1| unknown [Medicago truncatula] Length = 141 Score = 53.5 bits (127), Expect(3) = 5e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 1608 YIMQMPIRCELFDINLARAVQRDQVSLLGR 1519 Y M+MPIRCELFDINLA+AVQ+D+V+LLGR Sbjct: 112 YEMEMPIRCELFDINLAQAVQKDRVALLGR 141 Score = 33.5 bits (75), Expect(3) = 5e-09 Identities = 14/22 (63%), Positives = 19/22 (86%), Gaps = 2/22 (9%) Frame = -1 Query: 1724 GTKFFVVCEPGT--LQNFLKYI 1665 GTKFFVVCEPGT +++ LK++ Sbjct: 77 GTKFFVVCEPGTQQMESLLKFV 98 Score = 21.6 bits (44), Expect(3) = 5e-09 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 1669 IYELYTDY 1646 +YELYTDY Sbjct: 98 VYELYTDY 105 >ref|NP_195848.1| SNARE-like superfamily protein [Arabidopsis thaliana] gi|297806167|ref|XP_002870967.1| hypothetical protein ARALYDRAFT_908094 [Arabidopsis lyrata subsp. lyrata] gi|7406424|emb|CAB85533.1| putative protein [Arabidopsis thaliana] gi|21618125|gb|AAM67175.1| unknown [Arabidopsis thaliana] gi|28393092|gb|AAO41980.1| unknown protein [Arabidopsis thaliana] gi|28827482|gb|AAO50585.1| unknown protein [Arabidopsis thaliana] gi|297316804|gb|EFH47226.1| hypothetical protein ARALYDRAFT_908094 [Arabidopsis lyrata subsp. lyrata] gi|332003071|gb|AED90454.1| SNARE-like superfamily protein [Arabidopsis thaliana] Length = 141 Score = 49.3 bits (116), Expect(3) = 4e-08 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 1608 YIMQMPIRCELFDINLARAVQRDQVSLLGR 1519 Y ++MPIRCELFDINL +AVQ D+V+LLGR Sbjct: 112 YEIEMPIRCELFDINLTQAVQSDRVALLGR 141 Score = 34.3 bits (77), Expect(3) = 4e-08 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%) Frame = -1 Query: 1724 GTKFFVVCEPGT--LQNFLKYI 1665 GTKFFVVCEPGT +++ L+YI Sbjct: 77 GTKFFVVCEPGTPHMESLLRYI 98 Score = 21.9 bits (45), Expect(3) = 4e-08 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1669 IYELYTDY 1646 IYELYTDY Sbjct: 98 IYELYTDY 105 >ref|XP_003616027.1| Trafficking protein particle complex subunit [Medicago truncatula] gi|355517362|gb|AES98985.1| Trafficking protein particle complex subunit [Medicago truncatula] Length = 141 Score = 46.6 bits (109), Expect(3) = 5e-07 Identities = 19/30 (63%), Positives = 28/30 (93%) Frame = -3 Query: 1608 YIMQMPIRCELFDINLARAVQRDQVSLLGR 1519 Y ++MPIRCELFD+NL ++VQ+D+V+LLG+ Sbjct: 112 YEIEMPIRCELFDMNLTQSVQKDRVALLGQ 141 Score = 33.5 bits (75), Expect(3) = 5e-07 Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 2/22 (9%) Frame = -1 Query: 1724 GTKFFVVCEPGT--LQNFLKYI 1665 GTKFF VCEPGT +++ LKY+ Sbjct: 77 GTKFFAVCEPGTQQIESLLKYV 98 Score = 21.6 bits (44), Expect(3) = 5e-07 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 1669 IYELYTDY 1646 +YELYTDY Sbjct: 98 VYELYTDY 105