BLASTX nr result
ID: Scutellaria22_contig00008734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00008734 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] 64 1e-08 ref|XP_002277620.1| PREDICTED: uncharacterized protein LOC100253... 63 3e-08 ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|1... 62 4e-08 ref|XP_002514909.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 emb|CBI27661.3| unnamed protein product [Vitis vinifera] 60 1e-07 >emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] Length = 272 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%), Gaps = 5/43 (11%) Frame = -2 Query: 362 VEKMYAEAFLCNKYRVHAVGRLWHFEIPPAANL-----NSGFC 249 VEK+YAE FLC KY V +VGRLWHFEIPPAANL ++GFC Sbjct: 230 VEKVYAEEFLCRKYLVGSVGRLWHFEIPPAANLSRASDSTGFC 272 >ref|XP_002277620.1| PREDICTED: uncharacterized protein LOC100253955 [Vitis vinifera] Length = 282 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 5/43 (11%) Frame = -2 Query: 362 VEKMYAEAFLCNKYRVHAVGRLWHFEIPPAANL-----NSGFC 249 VEK+YAE LC KY+V +VGRLWHFEIPPAANL ++GFC Sbjct: 240 VEKVYAEELLCRKYQVGSVGRLWHFEIPPAANLSRASDSTGFC 282 >ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|118483182|gb|ABK93495.1| unknown [Populus trichocarpa] gi|222845100|gb|EEE82647.1| predicted protein [Populus trichocarpa] Length = 285 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = -2 Query: 362 VEKMYAEAFLCNKYRVHAVGRLWHFEIPPAANLNSG---FC 249 VEKM+AE FLC KY V AVGRLWHFEIPPAAN++ FC Sbjct: 245 VEKMFAEEFLCRKYLVKAVGRLWHFEIPPAANVSQSDGWFC 285 >ref|XP_002514909.1| conserved hypothetical protein [Ricinus communis] gi|223545960|gb|EEF47463.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = -2 Query: 362 VEKMYAEAFLCNKYRVHAVGRLWHFEIPPAANLN---SGFC 249 VEK+YAE FLC KY V AVGRLWHFE+PPAAN++ FC Sbjct: 245 VEKIYAEEFLCRKYLVKAVGRLWHFELPPAANVSLTGDSFC 285 >emb|CBI27661.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 362 VEKMYAEAFLCNKYRVHAVGRLWHFEIPPAANLN 261 VEK+YAE LC KY+V +VGRLWHFEIPPAANL+ Sbjct: 239 VEKVYAEELLCRKYQVGSVGRLWHFEIPPAANLS 272