BLASTX nr result
ID: Scutellaria22_contig00008593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00008593 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Ar... 155 5e-36 ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819... 155 5e-36 gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] 154 6e-36 ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|111... 154 8e-36 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 152 3e-35 >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Score = 155 bits (391), Expect = 5e-36 Identities = 71/83 (85%), Positives = 81/83 (97%) Frame = -2 Query: 532 IVVDFTASWCGPCRFIAPFFAELAKKLPNVTFLKVDVDELKTVAADWAVEAMPTFIFLKD 353 +VVDFTASWCGPCRFIAPFFA+LAKKLPNV FLKVD DELK+VA+DWA++AMPTF+FLK+ Sbjct: 41 VVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKE 100 Query: 352 GKILDRVVGAKKEELQSTIAKHL 284 GKILD+VVGAKK+ELQSTIAKHL Sbjct: 101 GKILDKVVGAKKDELQSTIAKHL 123 >ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819804|ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|267122|sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 1; Short=AtTRX1 gi|16552|emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana] gi|1388080|gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana] gi|6562255|emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana] gi|21617958|gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana] gi|297323623|gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|332645218|gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana] Length = 114 Score = 155 bits (391), Expect = 5e-36 Identities = 71/83 (85%), Positives = 81/83 (97%) Frame = -2 Query: 532 IVVDFTASWCGPCRFIAPFFAELAKKLPNVTFLKVDVDELKTVAADWAVEAMPTFIFLKD 353 +VVDFTASWCGPCRFIAPFFA+LAKKLPNV FLKVD DELK+VA+DWA++AMPTF+FLK+ Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKE 90 Query: 352 GKILDRVVGAKKEELQSTIAKHL 284 GKILD+VVGAKK+ELQSTIAKHL Sbjct: 91 GKILDKVVGAKKDELQSTIAKHL 113 >gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] Length = 119 Score = 154 bits (390), Expect = 6e-36 Identities = 73/88 (82%), Positives = 80/88 (90%) Frame = -2 Query: 532 IVVDFTASWCGPCRFIAPFFAELAKKLPNVTFLKVDVDELKTVAADWAVEAMPTFIFLKD 353 +VVDFTASWCGPCRFIAPF AELAKKLPNV FLKVDVDELK+VA DWAVEAMPTF+FLK+ Sbjct: 32 VVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKE 91 Query: 352 GKILDRVVGAKKEELQSTIAKHLNAVGA 269 GKI+D+VVG+KKEELQ TIAKHL A Sbjct: 92 GKIVDKVVGSKKEELQQTIAKHLATASA 119 >ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|11135282|sp|Q43636.1|TRXH_RICCO RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1255954|emb|CAA94534.1| thioredoxin [Ricinus communis] gi|223525803|gb|EEF28248.1| Thioredoxin H-type [Ricinus communis] Length = 118 Score = 154 bits (389), Expect = 8e-36 Identities = 72/83 (86%), Positives = 80/83 (96%) Frame = -2 Query: 532 IVVDFTASWCGPCRFIAPFFAELAKKLPNVTFLKVDVDELKTVAADWAVEAMPTFIFLKD 353 IVVDFTASWCGPCRFIAPF AELAKKLPNVTFLKVDVDELKTVA +WAVE+MPTF+FLK+ Sbjct: 31 IVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKE 90 Query: 352 GKILDRVVGAKKEELQSTIAKHL 284 GKI+D+VVGAKK+ELQ TIAKH+ Sbjct: 91 GKIMDKVVGAKKDELQQTIAKHM 113 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 152 bits (384), Expect = 3e-35 Identities = 72/88 (81%), Positives = 79/88 (89%) Frame = -2 Query: 532 IVVDFTASWCGPCRFIAPFFAELAKKLPNVTFLKVDVDELKTVAADWAVEAMPTFIFLKD 353 IVVDFTASWCGPCRFI+P AE AKK+P+VTFLKVDVDELKTVA DWAVEAMPTF+FLK+ Sbjct: 30 IVVDFTASWCGPCRFISPILAEFAKKMPHVTFLKVDVDELKTVAEDWAVEAMPTFMFLKE 89 Query: 352 GKILDRVVGAKKEELQSTIAKHLNAVGA 269 GKI+D+VVGAKKEELQ TIAKH V A Sbjct: 90 GKIIDKVVGAKKEELQQTIAKHATEVAA 117