BLASTX nr result
ID: Scutellaria22_contig00008504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00008504 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21853.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002273215.1| PREDICTED: two pore calcium channel protein ... 65 6e-09 gb|ACH53197.1| two pore channel 1 [Vitis vinifera] 65 6e-09 ref|XP_002517914.1| Voltage-dependent L-type calcium channel, pu... 59 3e-07 sp|Q6S5H8.1|TPC1_HORVU RecName: Full=Two pore calcium channel pr... 58 7e-07 >emb|CBI21853.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +2 Query: 170 DAGGSGGSIKDHRNVFNRRSEAIAHGSPYQKAAALVDLAEHGIGIPE 310 D SGG + VF+RRS+AIA+GSPYQKAAALVDLAE GIG+PE Sbjct: 7 DGESSGGRRRGQTPVFHRRSDAIAYGSPYQKAAALVDLAEDGIGLPE 53 >ref|XP_002273215.1| PREDICTED: two pore calcium channel protein 1A [Vitis vinifera] Length = 680 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +2 Query: 170 DAGGSGGSIKDHRNVFNRRSEAIAHGSPYQKAAALVDLAEHGIGIPE 310 D SGG + VF+RRS+AIA+GSPYQKAAALVDLAE GIG+PE Sbjct: 7 DGESSGGRRRGQTPVFHRRSDAIAYGSPYQKAAALVDLAEDGIGLPE 53 >gb|ACH53197.1| two pore channel 1 [Vitis vinifera] Length = 680 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +2 Query: 170 DAGGSGGSIKDHRNVFNRRSEAIAHGSPYQKAAALVDLAEHGIGIPE 310 D SGG + VF+RRS+AIA+GSPYQKAAALVDLAE GIG+PE Sbjct: 7 DGESSGGRRRGQTPVFHRRSDAIAYGSPYQKAAALVDLAEDGIGLPE 53 >ref|XP_002517914.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] gi|223542896|gb|EEF44432.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] Length = 743 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +2 Query: 173 AGGSGGSIKDHRNVFNRRSEAIAHGSPYQKAAALVDLAEHGIGIPE 310 +G S D FNRRS+AI GSPYQKAAALVDLAE G+G+PE Sbjct: 12 SGDRSFSDTDRTATFNRRSDAITRGSPYQKAAALVDLAEDGVGLPE 57 >sp|Q6S5H8.1|TPC1_HORVU RecName: Full=Two pore calcium channel protein 1; AltName: Full=Voltage-dependent calcium channel protein TPC1; Short=HvTPC1 gi|39545849|gb|AAR27998.1| two-pore calcium channel [Hordeum vulgare] Length = 742 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +2 Query: 170 DAGGSGGSIKDHRNVFNRRSEAIAHGSPYQKAAALVDLAEHGIGIPE 310 D GG GS K + RRS+A+AHG YQKAAALVDLAE G+GIPE Sbjct: 28 DGGGGQGSRK-----YRRRSDALAHGDRYQKAAALVDLAEDGVGIPE 69