BLASTX nr result
ID: Scutellaria22_contig00007952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00007952 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535120.1| PREDICTED: reticuline oxidase-like protein-l... 144 1e-32 ref|XP_003535119.1| PREDICTED: reticuline oxidase-like protein-l... 144 1e-32 ref|XP_002523162.1| Reticuline oxidase precursor, putative [Rici... 142 2e-32 ref|XP_002523164.1| Reticuline oxidase precursor, putative [Rici... 142 4e-32 ref|XP_002538825.1| Reticuline oxidase precursor, putative [Rici... 142 4e-32 >ref|XP_003535120.1| PREDICTED: reticuline oxidase-like protein-like isoform 2 [Glycine max] Length = 540 Score = 144 bits (362), Expect = 1e-32 Identities = 67/78 (85%), Positives = 71/78 (91%) Frame = -3 Query: 235 SWIESVLYIAGYPPKTPPEVLLQGKSLFKNFFKAKSDFVRMPIPEAGLNGLWKRLMEEDS 56 SWI+SVLYIAGYP TPPEVLLQGKS FKN+FKAKSDFVR PIPE GL GLW+RL+EEDS Sbjct: 336 SWIKSVLYIAGYPNDTPPEVLLQGKSTFKNYFKAKSDFVRDPIPETGLEGLWQRLLEEDS 395 Query: 55 PLMIWNPYGGMMSKISES 2 PLMIWNPYGGMMSK SES Sbjct: 396 PLMIWNPYGGMMSKFSES 413 >ref|XP_003535119.1| PREDICTED: reticuline oxidase-like protein-like isoform 1 [Glycine max] Length = 543 Score = 144 bits (362), Expect = 1e-32 Identities = 67/78 (85%), Positives = 71/78 (91%) Frame = -3 Query: 235 SWIESVLYIAGYPPKTPPEVLLQGKSLFKNFFKAKSDFVRMPIPEAGLNGLWKRLMEEDS 56 SWI+SVLYIAGYP TPPEVLLQGKS FKN+FKAKSDFVR PIPE GL GLW+RL+EEDS Sbjct: 339 SWIKSVLYIAGYPNDTPPEVLLQGKSTFKNYFKAKSDFVRDPIPETGLEGLWQRLLEEDS 398 Query: 55 PLMIWNPYGGMMSKISES 2 PLMIWNPYGGMMSK SES Sbjct: 399 PLMIWNPYGGMMSKFSES 416 >ref|XP_002523162.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537569|gb|EEF39193.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 548 Score = 142 bits (359), Expect = 2e-32 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = -3 Query: 235 SWIESVLYIAGYPPKTPPEVLLQGKSLFKNFFKAKSDFVRMPIPEAGLNGLWKRLMEEDS 56 SWI+SVLYIAGYP TPPEVLLQGKSLFKN+FKAKSDFV+ PIPE GL GLW+RL++E+S Sbjct: 343 SWIKSVLYIAGYPSTTPPEVLLQGKSLFKNYFKAKSDFVKEPIPETGLQGLWERLLQEES 402 Query: 55 PLMIWNPYGGMMSKISES 2 PLMIWNPYGGMM KISES Sbjct: 403 PLMIWNPYGGMMGKISES 420 >ref|XP_002523164.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537571|gb|EEF39195.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 548 Score = 142 bits (357), Expect = 4e-32 Identities = 65/78 (83%), Positives = 71/78 (91%) Frame = -3 Query: 235 SWIESVLYIAGYPPKTPPEVLLQGKSLFKNFFKAKSDFVRMPIPEAGLNGLWKRLMEEDS 56 SWI+SVLYIAGYP TPPEVLLQGKSLFKN+FKAKSDFV+ PIPE L GLWKRL++E+S Sbjct: 343 SWIKSVLYIAGYPSTTPPEVLLQGKSLFKNYFKAKSDFVKEPIPETALQGLWKRLLQEES 402 Query: 55 PLMIWNPYGGMMSKISES 2 PLMIWNPYGGMM KISES Sbjct: 403 PLMIWNPYGGMMGKISES 420 >ref|XP_002538825.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223510249|gb|EEF23558.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 326 Score = 142 bits (357), Expect = 4e-32 Identities = 65/78 (83%), Positives = 71/78 (91%) Frame = -3 Query: 235 SWIESVLYIAGYPPKTPPEVLLQGKSLFKNFFKAKSDFVRMPIPEAGLNGLWKRLMEEDS 56 SWI+SVLYIAGYP TPPEVLLQGKSLFKN+FKAKSDFV+ PIPE L GLWKRL++E+S Sbjct: 121 SWIKSVLYIAGYPSTTPPEVLLQGKSLFKNYFKAKSDFVKEPIPETALQGLWKRLLQEES 180 Query: 55 PLMIWNPYGGMMSKISES 2 PLMIWNPYGGMM KISES Sbjct: 181 PLMIWNPYGGMMGKISES 198