BLASTX nr result
ID: Scutellaria22_contig00007730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00007730 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32713.3| unnamed protein product [Vitis vinifera] 56 6e-06 >emb|CBI32713.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +1 Query: 460 QMMSGDVFSVPSSQAAKVFPLESQQNPTS-KPPASTKKRRNLPGTPDPDA 606 QMMSGD+FS+PSS + F + NP + KPP KK+RNLPGTPDPDA Sbjct: 2 QMMSGDMFSIPSS--IRTFAQDPDANPNNLKPPP--KKKRNLPGTPDPDA 47