BLASTX nr result
ID: Scutellaria22_contig00007683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00007683 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533457.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 ref|XP_002323285.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_002533458.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|NP_001242454.1| uncharacterized protein LOC100803981 [Glycin... 69 5e-10 ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containin... 67 2e-09 >ref|XP_002533457.1| conserved hypothetical protein [Ricinus communis] gi|223526690|gb|EEF28926.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 130 LMDTRKRGRGEF-ANGGFKKPKSEMDSLSSGIGSKSKPCTKFFS 2 +MDTRKRGR +F ANGGFKK K EMDSLS+G+GSKSKPCTKFFS Sbjct: 1 MMDTRKRGRNDFNANGGFKKSKREMDSLSTGVGSKSKPCTKFFS 44 >ref|XP_002323285.1| predicted protein [Populus trichocarpa] gi|222867915|gb|EEF05046.1| predicted protein [Populus trichocarpa] Length = 285 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/46 (73%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = -3 Query: 130 LMDTRKRGRGEFAN---GGFKKPKSEMDSLSSGIGSKSKPCTKFFS 2 +MDTRKRGR +F GGFKK K EMDSLS+G+GSKSKPCTKFFS Sbjct: 1 MMDTRKRGRPDFGTNGYGGFKKSKQEMDSLSTGVGSKSKPCTKFFS 46 >ref|XP_002533458.1| conserved hypothetical protein [Ricinus communis] gi|223526691|gb|EEF28927.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -3 Query: 130 LMDTRKRGRGEF-ANGGFKKPKSEMDSLSSGIGSKSKPCTKFFS 2 +MD RKRGR +F NGGFKK + EMDS S+G+GSKSKPCTKFFS Sbjct: 1 MMDIRKRGRNDFNVNGGFKKSRKEMDSFSTGVGSKSKPCTKFFS 44 >ref|NP_001242454.1| uncharacterized protein LOC100803981 [Glycine max] gi|255636900|gb|ACU18783.1| unknown [Glycine max] Length = 295 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 3/45 (6%) Frame = -3 Query: 127 MDTRKRGRGE---FANGGFKKPKSEMDSLSSGIGSKSKPCTKFFS 2 MDTRKRGR E NGGFKK K EM+SLS+G+GSKSKPCTKFFS Sbjct: 1 MDTRKRGRPEPGFSLNGGFKKSKQEMESLSTGVGSKSKPCTKFFS 45 >ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like isoform 1 [Vitis vinifera] Length = 297 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 3/45 (6%) Frame = -3 Query: 127 MDTRKRGR---GEFANGGFKKPKSEMDSLSSGIGSKSKPCTKFFS 2 MDTRKRGR ANGGFKK K E++SLS+GIGSKSKPCTKFFS Sbjct: 1 MDTRKRGRPGGALNANGGFKKSKQEVESLSTGIGSKSKPCTKFFS 45