BLASTX nr result
ID: Scutellaria22_contig00003931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00003931 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533913.1| NAC domain-containing protein, putative [Ric... 71 8e-11 emb|CCO75402.1| Nac2 transcription factor [Arachis hypogaea] 70 2e-10 gb|ADM94307.1| NAC transcription factor [Arachis hypogaea] 70 2e-10 gb|ADL36797.1| NAC domain class transcription factor [Malus x do... 70 2e-10 gb|ACU19814.1| unknown [Glycine max] 70 2e-10 >ref|XP_002533913.1| NAC domain-containing protein, putative [Ricinus communis] gi|223526123|gb|EEF28468.1| NAC domain-containing protein, putative [Ricinus communis] Length = 337 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 169 MGMGEMDPCSQLSLPPGFRFFPTDEELLVQYLCRKVA 279 MG+ EMDP +QLSLPPGFRF+PTDEELLVQYLCRKVA Sbjct: 1 MGVQEMDPLTQLSLPPGFRFYPTDEELLVQYLCRKVA 37 >emb|CCO75402.1| Nac2 transcription factor [Arachis hypogaea] Length = 349 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 169 MGMGEMDPCSQLSLPPGFRFFPTDEELLVQYLCRKVA 279 MG+ E DP SQLSLPPGFRF+PTDEELLVQYLCRKVA Sbjct: 1 MGIQEKDPLSQLSLPPGFRFYPTDEELLVQYLCRKVA 37 >gb|ADM94307.1| NAC transcription factor [Arachis hypogaea] Length = 349 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 169 MGMGEMDPCSQLSLPPGFRFFPTDEELLVQYLCRKVA 279 MG+ E DP SQLSLPPGFRF+PTDEELLVQYLCRKVA Sbjct: 1 MGIQEKDPLSQLSLPPGFRFYPTDEELLVQYLCRKVA 37 >gb|ADL36797.1| NAC domain class transcription factor [Malus x domestica] Length = 336 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 169 MGMGEMDPCSQLSLPPGFRFFPTDEELLVQYLCRKVA 279 MG+ E DP SQLSLPPGFRF+PTDEELLVQYLCRKVA Sbjct: 1 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVA 37 >gb|ACU19814.1| unknown [Glycine max] Length = 268 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 169 MGMGEMDPCSQLSLPPGFRFFPTDEELLVQYLCRKVA 279 MG+ E DP SQLSLPPGFRF+PTDEELLVQYLCRKVA Sbjct: 1 MGVPEKDPLSQLSLPPGFRFYPTDEELLVQYLCRKVA 37