BLASTX nr result
ID: Scutellaria22_contig00003775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00003775 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncat... 62 5e-08 ref|YP_588403.1| hypothetical protein ZeamMp158 [Zea mays subsp.... 55 5e-06 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 55 6e-06 >ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula] gi|355477374|gb|AES58577.1| ATP synthase subunit alpha [Medicago truncatula] Length = 1116 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 158 VRHAPFSFFRSR---RGVLNPLRTTPPGRSPECRVFL 57 +RHAPF FRSR RGVLNPLRTTPPG SPECRVFL Sbjct: 698 LRHAPFCLFRSRLFWRGVLNPLRTTPPGGSPECRVFL 734 >ref|YP_588403.1| hypothetical protein ZeamMp158 [Zea mays subsp. mays] gi|40795104|gb|AAR91148.1| hypothetical protein (mitochondrion) [Zea mays] Length = 111 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 123 PAPKERKRCVPHSRRTTSDILEEGGDDV 206 PAPK+RKRCVPHSR T S+ILEEGGDDV Sbjct: 38 PAPKQRKRCVPHSRGTASEILEEGGDDV 65 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = +3 Query: 114 YAPP---APKERKRCVPHSRRTTSDILEEGGDDV 206 YAPP APK+ KRC+PHSR T SDILEEGGDDV Sbjct: 388 YAPPKQTAPKQTKRCMPHSRGTASDILEEGGDDV 421