BLASTX nr result
ID: Scutellaria22_contig00003425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00003425 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565787.1| light-harvesting complex II chlorophyll a/b bin... 211 1e-57 ref|XP_002879498.1| LHB1B1 [Arabidopsis lyrata subsp. lyrata] gi... 211 1e-57 ref|NP_565786.1| light-harvesting complex II chlorophyll a/b bin... 211 1e-57 ref|XP_002893588.1| hypothetical protein ARALYDRAFT_473203 [Arab... 211 1e-57 ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arab... 211 1e-57 >ref|NP_565787.1| light-harvesting complex II chlorophyll a/b binding protein 1 [Arabidopsis thaliana] gi|11908034|gb|AAG41446.1|AF326864_1 putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|12642854|gb|AAK00369.1|AF339687_1 putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|16366|emb|CAA45789.1| photosystem II type I chlorophyll a /b binding protein [Arabidopsis thaliana] gi|3128229|gb|AAC26709.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|20197164|gb|AAM14951.1| putative photosystem II type I chlorophyll a b binding protein [Arabidopsis thaliana] gi|21539563|gb|AAM53334.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|25083751|gb|AAN72114.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|330253879|gb|AEC08973.1| light-harvesting complex II chlorophyll a/b binding protein 1 [Arabidopsis thaliana] Length = 266 Score = 211 bits (537), Expect(2) = 1e-57 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -1 Query: 325 LGPVLR*APSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 146 LGP PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEL Sbjct: 58 LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEL 117 Query: 145 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQV 2 LARNGVKFGEAVWFKAGSQIFS+GGLDYLGNPSLVHAQSILAIWATQV Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQV 165 Score = 37.0 bits (84), Expect(2) = 1e-57 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 348 YGPDRVKYLGPFSGEP 301 YG DRVKYLGPFSGEP Sbjct: 50 YGSDRVKYLGPFSGEP 65 >ref|XP_002879498.1| LHB1B1 [Arabidopsis lyrata subsp. lyrata] gi|297325337|gb|EFH55757.1| LHB1B1 [Arabidopsis lyrata subsp. lyrata] Length = 266 Score = 211 bits (537), Expect(2) = 1e-57 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -1 Query: 325 LGPVLR*APSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 146 LGP PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEL Sbjct: 58 LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEL 117 Query: 145 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQV 2 LARNGVKFGEAVWFKAGSQIFS+GGLDYLGNPSLVHAQSILAIWATQV Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQV 165 Score = 37.0 bits (84), Expect(2) = 1e-57 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 348 YGPDRVKYLGPFSGEP 301 YG DRVKYLGPFSGEP Sbjct: 50 YGSDRVKYLGPFSGEP 65 >ref|NP_565786.1| light-harvesting complex II chlorophyll a/b binding protein 1 [Arabidopsis thaliana] gi|13926260|gb|AAK49602.1|AF372886_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16226426|gb|AAL16165.1|AF428397_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16930391|gb|AAL31882.1|AF419548_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16930467|gb|AAL31919.1|AF419587_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16364|emb|CAA45790.1| photosystem II type I chlorophyll a /b binding protein [Arabidopsis thaliana] gi|3128230|gb|AAC26710.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|14517452|gb|AAK62616.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|15027899|gb|AAK76480.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|17473689|gb|AAL38301.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|19310503|gb|AAL84985.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|19310521|gb|AAL84994.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|20148517|gb|AAM10149.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|20197168|gb|AAM14954.1| photosystem II type I chlorophyll a b binding protein [Arabidopsis thaliana] gi|23296426|gb|AAN13114.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|110739111|dbj|BAF01472.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|330253878|gb|AEC08972.1| light-harvesting complex II chlorophyll a/b binding protein 1 [Arabidopsis thaliana] Length = 265 Score = 211 bits (537), Expect(2) = 1e-57 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -1 Query: 325 LGPVLR*APSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 146 LGP PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEL Sbjct: 57 LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEL 116 Query: 145 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQV 2 LARNGVKFGEAVWFKAGSQIFS+GGLDYLGNPSLVHAQSILAIWATQV Sbjct: 117 LARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQV 164 Score = 37.0 bits (84), Expect(2) = 1e-57 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 348 YGPDRVKYLGPFSGEP 301 YG DRVKYLGPFSGEP Sbjct: 49 YGSDRVKYLGPFSGEP 64 >ref|XP_002893588.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. lyrata] gi|297339430|gb|EFH69847.1| hypothetical protein ARALYDRAFT_473203 [Arabidopsis lyrata subsp. lyrata] Length = 262 Score = 211 bits (537), Expect(2) = 1e-57 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -1 Query: 325 LGPVLR*APSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 146 LGP PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEL Sbjct: 54 LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEL 113 Query: 145 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQV 2 LARNGVKFGEAVWFKAGSQIFS+GGLDYLGNPSLVHAQSILAIWATQV Sbjct: 114 LARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQV 161 Score = 37.0 bits (84), Expect(2) = 1e-57 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 348 YGPDRVKYLGPFSGEP 301 YG DRVKYLGPFSGEP Sbjct: 46 YGSDRVKYLGPFSGEP 61 >ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. lyrata] gi|297336680|gb|EFH67097.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. lyrata] Length = 262 Score = 211 bits (537), Expect(2) = 1e-57 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -1 Query: 325 LGPVLR*APSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL 146 LGP PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEL Sbjct: 54 LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEL 113 Query: 145 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQV 2 LARNGVKFGEAVWFKAGSQIFS+GGLDYLGNPSLVHAQSILAIWATQV Sbjct: 114 LARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQV 161 Score = 37.0 bits (84), Expect(2) = 1e-57 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 348 YGPDRVKYLGPFSGEP 301 YG DRVKYLGPFSGEP Sbjct: 46 YGSDRVKYLGPFSGEP 61