BLASTX nr result
ID: Scutellaria22_contig00001283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00001283 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein... 83 3e-14 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding pro... 82 6e-14 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein... 80 2e-13 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein... 79 4e-13 dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein... 79 5e-13 >dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = +1 Query: 58 MASSTMALSSPSFAGQAVKLSSATPQLSGNGRVSMRKTAAKPAASTSPW 204 MA+STMALSSPSFAGQAVKLS + P+++GNGRVSMRKT AKP AS+SPW Sbjct: 1 MAASTMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPW 49 >sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor gi|19823|emb|CAA36957.1| unnamed protein product [Nicotiana tabacum] Length = 265 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = +1 Query: 58 MASSTMALSSPSFAGQAVKLSSATPQLSGNGRVSMRKTAAKPAASTSPW 204 MA++TMALSSPSFAGQAVKLS + P+++GNGRVSMRKT AKP AS+SPW Sbjct: 1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPW 49 >dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +1 Query: 58 MASSTMALSSPSFAGQAVKLSSATPQLSGNGRVSMRKTAAKPAASTSPW 204 MA+STMALSSPSFAGQAVKLS + +++GNGRVSMRKT AKP AS+SPW Sbjct: 1 MAASTMALSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSSPW 49 >dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 58 MASSTMALSSPSFAGQAVKLSSATPQLSGNGRVSMRKTAAKPAASTSPW 204 MA++TMALSSPSFAGQAVKLS + +++GNGRVSMRKTAAKP +S+SPW Sbjct: 1 MAAATMALSSPSFAGQAVKLSPSASEITGNGRVSMRKTAAKPVSSSSPW 49 >dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +1 Query: 58 MASSTMALSSPSFAGQAVKLSSATPQLSGNGRVSMRKTAAKPAASTSPW 204 MA++TMALSSPSFAGQAVKLS + +++GNGRVSMRKT AKP AS+SPW Sbjct: 1 MAAATMALSSPSFAGQAVKLSPSASEITGNGRVSMRKTVAKPVASSSPW 49