BLASTX nr result
ID: Scutellaria22_contig00001282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00001282 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACT34765.1| galactinol synthase [Salvia miltiorrhiza] 64 1e-08 sp|Q9XGN4.1|GOLS1_AJURE RecName: Full=Galactinol synthase 1; Sho... 59 4e-07 gb|ABQ12641.1| galactinol synthase 2 [Verbascum phoeniceum] 59 5e-07 gb|AAU43781.1| galactinol synthase [Castanea sativa] 58 7e-07 gb|ABQ12640.1| galactinol synthase 1 [Verbascum phoeniceum] 56 3e-06 >gb|ACT34765.1| galactinol synthase [Salvia miltiorrhiza] Length = 332 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/38 (84%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = -2 Query: 440 DETLDYKGEE-EESFSKPSIIASLPEPAVSYIPAPSAA 330 DE+LDYK EE +ESFSKPSI+ASLPEPAVSY+PAPSAA Sbjct: 295 DESLDYKPEEADESFSKPSIMASLPEPAVSYVPAPSAA 332 >sp|Q9XGN4.1|GOLS1_AJURE RecName: Full=Galactinol synthase 1; Short=ArGolS1; Short=GolS-1 gi|5608497|emb|CAB51533.1| galactinol synthase, isoform GolS-1 [Ajuga reptans] Length = 333 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 4/41 (9%) Frame = -2 Query: 440 DETLDYKGEE----EESFSKPSIIASLPEPAVSYIPAPSAA 330 DE+LD+K E+ EE+FS PS IASLPEPAVSYIPAPSAA Sbjct: 293 DESLDFKAEDSIAGEETFSMPSFIASLPEPAVSYIPAPSAA 333 >gb|ABQ12641.1| galactinol synthase 2 [Verbascum phoeniceum] Length = 328 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -2 Query: 440 DETLDYKGEEEE-SFSKPSIIASLPEPAVSYIPAPSAA 330 D +LDY EEEE SFSKPSI++++PEPAVSYIPAPSAA Sbjct: 291 DASLDYNPEEEEESFSKPSIMSAMPEPAVSYIPAPSAA 328 >gb|AAU43781.1| galactinol synthase [Castanea sativa] Length = 337 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 4/41 (9%) Frame = -2 Query: 440 DETLDYKGE----EEESFSKPSIIASLPEPAVSYIPAPSAA 330 DE+LD+KGE EEE+FSK SI+AS+PEP +SYIPAP+AA Sbjct: 297 DESLDFKGENPVSEEETFSKSSIMASMPEPTISYIPAPTAA 337 >gb|ABQ12640.1| galactinol synthase 1 [Verbascum phoeniceum] Length = 325 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 4/41 (9%) Frame = -2 Query: 440 DETLDYKGEE----EESFSKPSIIASLPEPAVSYIPAPSAA 330 DE+LD+K E +E+FS+PSI+A++PEPA+SYIPAPSAA Sbjct: 285 DESLDFKANETIVEDETFSRPSIMAAMPEPAISYIPAPSAA 325