BLASTX nr result
ID: Scutellaria22_contig00001074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00001074 (520 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] 70 2e-10 sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein... 62 4e-08 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 60 2e-07 ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|4... 60 2e-07 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 60 2e-07 >gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] Length = 63 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 96 MSDKCGNCDCADTTQCTKKGYAADIIETEKSYAAVMEVP 212 MSDKCG+CDCAD +QC K GY ADIIETEKSYA VM+ P Sbjct: 1 MSDKCGSCDCADKSQCGKNGYTADIIETEKSYAMVMDAP 39 >sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein type 3 gi|1086020|pir||S48037 metallothionein-like protein - kiwi fruit gi|450241|gb|AAA53072.1| metallothionein-like protein [Actinidia deliciosa] Length = 63 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 96 MSDKCGNCDCADTTQCTKKGYAADIIETEKSYA--AVMEVP 212 MSDKCGNCDCAD++QC KKG + DI+ET+KSY VM VP Sbjct: 1 MSDKCGNCDCADSSQCVKKGNSIDIVETDKSYIEDVVMGVP 41 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 4/43 (9%) Frame = +3 Query: 96 MSDKCGNCDCADTTQCTKKG--YAADIIETEKSYAA--VMEVP 212 MS CGNCDCAD +QC KKG Y ADI+ETEKS+ + VMEVP Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVP 43 >ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|46850189|gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gi|118488217|gb|ABK95928.1| unknown [Populus trichocarpa] gi|118489949|gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] gi|222859959|gb|EEE97506.1| predicted protein [Populus trichocarpa] Length = 66 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/43 (69%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = +3 Query: 96 MSDKCGNCDCADTTQCTKKG--YAADIIETEKS--YAAVMEVP 212 MS C NCDCAD TQC KKG Y ADI+ETEKS Y VMEVP Sbjct: 1 MSSTCDNCDCADKTQCVKKGSSYTADIVETEKSHVYTGVMEVP 43 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = +3 Query: 96 MSDKCGNCDCADTTQCTKKG--YAADIIETEKS-YAAVMEVP 212 MSD CGNCDCAD TQC KKG Y ADIIETEKS VM+ P Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAP 42