BLASTX nr result
ID: Salvia21_contig00040669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00040669 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78668.1| hypothetical protein VITISV_031288 [Vitis vinifera] 80 2e-13 ref|XP_004147438.1| PREDICTED: uncharacterized protein LOC101217... 72 4e-11 ref|XP_002305043.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|XP_002521341.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003565569.1| PREDICTED: uncharacterized protein LOC100826... 55 8e-06 >emb|CAN78668.1| hypothetical protein VITISV_031288 [Vitis vinifera] Length = 224 Score = 79.7 bits (195), Expect = 2e-13 Identities = 42/74 (56%), Positives = 49/74 (66%), Gaps = 11/74 (14%) Frame = +2 Query: 2 KGPKNVKELERLERWIKHFSN------EEPFRLAHLLLGKAAFVHSDDG-----FGGLAF 148 KGPK KE+ERLE W+KHF N EP RLAH+LLGKA F + G F GL F Sbjct: 150 KGPKCGKEVERLEGWVKHFYNGGEEERREPLRLAHMLLGKAVFDSENSGGGGGGFRGLEF 209 Query: 149 PSTIDEFLQNEPPS 190 PSTI+EFL N+PP+ Sbjct: 210 PSTIEEFLHNDPPT 223 >ref|XP_004147438.1| PREDICTED: uncharacterized protein LOC101217056 [Cucumis sativus] gi|449527135|ref|XP_004170568.1| PREDICTED: uncharacterized LOC101217056 [Cucumis sativus] Length = 231 Score = 72.4 bits (176), Expect = 4e-11 Identities = 39/72 (54%), Positives = 48/72 (66%), Gaps = 9/72 (12%) Frame = +2 Query: 2 KGPKNVKELERLERWIKHFSNE-------EPFRLAHLLLGKAAFVHSDDG--FGGLAFPS 154 KGPK KE+ERL WI+ FSN EP RLA+LLLGKA F +DD GL FPS Sbjct: 159 KGPKCRKEVERLNGWIEFFSNGGDEEDRLEPLRLAYLLLGKAVFASNDDDGCLEGLEFPS 218 Query: 155 TIDEFLQNEPPS 190 T+++FL N+PP+ Sbjct: 219 TVEDFLLNDPPA 230 >ref|XP_002305043.1| predicted protein [Populus trichocarpa] gi|222848007|gb|EEE85554.1| predicted protein [Populus trichocarpa] Length = 217 Score = 68.2 bits (165), Expect = 7e-10 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%) Frame = +2 Query: 2 KGPKNVKELERLERWIKHFSNE------EPFRLAHLLLGKAAFVHSDDGFGGLAFPSTID 163 KGPK KE+ERLE WI++F + EP LA LLLGKAA+ GGL FPSTI+ Sbjct: 148 KGPKCEKEVERLEGWIRYFLGDGGEERREPLMLAFLLLGKAAYELEGADGGGLDFPSTIE 207 Query: 164 EFLQNEPP 187 EFL+ +PP Sbjct: 208 EFLKLDPP 215 >ref|XP_002521341.1| conserved hypothetical protein [Ricinus communis] gi|223539419|gb|EEF41009.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 9/71 (12%) Frame = +2 Query: 2 KGPKNVKELERLERWIKHFSNE---------EPFRLAHLLLGKAAFVHSDDGFGGLAFPS 154 KGPK E++RLERWI +F + EP RLA LLLG+A F GL FPS Sbjct: 153 KGPKCKIEMDRLERWIDYFLHNSECGAEGRMEPLRLAFLLLGRATFELDT----GLDFPS 208 Query: 155 TIDEFLQNEPP 187 TI++FL+ +PP Sbjct: 209 TIEDFLKYDPP 219 >ref|XP_003565569.1| PREDICTED: uncharacterized protein LOC100826430 [Brachypodium distachyon] Length = 223 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 9/72 (12%) Frame = +2 Query: 5 GPKNVKELERLERWIKHFSN------EEPFRLAHLLLGKAAFVHSDDG---FGGLAFPST 157 GPK +E +R++ WI+H+ EP RLAHLLL KA++ +G LAFPS Sbjct: 140 GPKCEREKKRVDGWIRHYCPGDGGGCREPARLAHLLLAKASWTWDGEGPADRAALAFPSA 199 Query: 158 IDEFLQNEPPSP 193 + EFL + P P Sbjct: 200 VKEFLARDAPPP 211