BLASTX nr result
ID: Salvia21_contig00040373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00040373 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35565.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002271231.1| PREDICTED: cytochrome P450 734A1 [Vitis vini... 65 4e-09 emb|CBI16999.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002268401.1| PREDICTED: cytochrome P450 734A1-like [Vitis... 64 1e-08 emb|CBI16698.3| unnamed protein product [Vitis vinifera] 64 2e-08 >emb|CBI35565.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +1 Query: 37 KMLLPTFLALVLGFLIYLYTSLVMKPHKIQKMLRNQGIHGPPPKILLGNILEIKKS 204 K+ + LA VLG LY +LV+KP K++ +LR+QGI GPPP LLGNI EIKKS Sbjct: 7 KVFISLALAGVLGLFFRLYNALVVKPEKLRSILRSQGISGPPPSFLLGNIREIKKS 62 >ref|XP_002271231.1| PREDICTED: cytochrome P450 734A1 [Vitis vinifera] Length = 510 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +1 Query: 37 KMLLPTFLALVLGFLIYLYTSLVMKPHKIQKMLRNQGIHGPPPKILLGNILEIKKS 204 K+ + LA VLG LY +LV+KP K++ +LR+QGI GPPP LLGNI EIKKS Sbjct: 7 KVFISLALAGVLGLFFRLYNALVVKPEKLRSILRSQGISGPPPSFLLGNIREIKKS 62 >emb|CBI16999.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 37 KMLLPTFLALVLGFLIYLYTSLVMKPHKIQKMLRNQGIHGPPPKILLGNILEIKKS 204 K+ + L VLG LY +LV+KP K++ +LRNQGI GPPP LLGNI EIK+S Sbjct: 7 KLFISIALVGVLGLFFRLYNALVVKPKKLRSILRNQGISGPPPSFLLGNIREIKES 62 >ref|XP_002268401.1| PREDICTED: cytochrome P450 734A1-like [Vitis vinifera] Length = 510 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 37 KMLLPTFLALVLGFLIYLYTSLVMKPHKIQKMLRNQGIHGPPPKILLGNILEIKKS 204 K+ + L VLG LY +LV+KP K++ +LRNQGI GPPP LLGNI EIK+S Sbjct: 7 KLFISIALVGVLGLFFRLYNALVVKPKKLRSILRNQGISGPPPSFLLGNIREIKES 62 >emb|CBI16698.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +1 Query: 37 KMLLPTFLALVLGFLIYLYTSLVMKPHKIQKMLRNQGIHGPPPKILLGNILEIKK 201 ++++ L VLG IYLYT+L ++P ++Q LR QGI GPPP L GNI E+KK Sbjct: 27 RIIVSAVLGGVLGLFIYLYTTLFLQPRRLQSKLRRQGIRGPPPSFLFGNIAEMKK 81