BLASTX nr result
ID: Salvia21_contig00039615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00039615 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525065.1| protein phosphatase 2c, putative [Ricinus co... 56 3e-06 >ref|XP_002525065.1| protein phosphatase 2c, putative [Ricinus communis] gi|223535646|gb|EEF37312.1| protein phosphatase 2c, putative [Ricinus communis] Length = 237 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 TVIVLFLDSHLISRSSFQGPILSIKGGGVAPGDANT 110 TVIVLFLDSHLI+RSS +GP++SI+GG PG ANT Sbjct: 202 TVIVLFLDSHLINRSSCRGPLISIRGGNGIPGSANT 237