BLASTX nr result
ID: Salvia21_contig00038931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00038931 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC23045.1| monooxygenase [Solanum tuberosum] 55 3e-08 >dbj|BAC23045.1| monooxygenase [Solanum tuberosum] Length = 356 Score = 55.5 bits (132), Expect(2) = 3e-08 Identities = 25/59 (42%), Positives = 34/59 (57%), Gaps = 7/59 (11%) Frame = +1 Query: 73 GSGSPVSDARSVIRGFVAYHDGHVFEPKIYAY-------AFVPCDHKVVYWYCIFNPSL 228 G PV RS IRGFV + + H ++PK +AY F+P D K +YW+C F PS+ Sbjct: 117 GLQKPVYSGRSAIRGFVEFPEKHGYQPKFHAYFGGGVRFGFLPSDEKSLYWFCTFTPSV 175 Score = 26.9 bits (58), Expect(2) = 3e-08 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Frame = +3 Query: 36 ALIGCKGVNS----WLGLRE 83 ALIGC GVNS WLGL++ Sbjct: 101 ALIGCDGVNSVVANWLGLQK 120