BLASTX nr result
ID: Salvia21_contig00038914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00038914 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69797.1| Hop-interacting protein THI034 [Solanum lycopersi... 86 4e-15 ref|XP_002305325.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 gb|AFP44687.1| hypothetical protein, partial [Eragrostis tef] 71 1e-10 ref|XP_002517391.1| nuclease, putative [Ricinus communis] gi|223... 71 1e-10 ref|XP_002440405.1| hypothetical protein SORBIDRAFT_09g000480 [S... 69 3e-10 >gb|AEW69797.1| Hop-interacting protein THI034 [Solanum lycopersicum] Length = 288 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/73 (56%), Positives = 53/73 (72%) Frame = -2 Query: 219 VNDTSVRVFKGYGLTKEADAYLSSHGLKNAIYSVDASEVQDDRFGQLIICPFREPNXXXX 40 + + ++ VFKGY LTKE++ YL+SHGLKNA+YS+D S+V+DD FG LI CPFR+P Sbjct: 34 IGEPAISVFKGYRLTKESEEYLASHGLKNAMYSMDFSDVRDDLFGTLIPCPFRQPGSSKD 93 Query: 39 XXXXKNHQEKRPQ 1 KN QEKR Q Sbjct: 94 KIVGKNVQEKRMQ 106 >ref|XP_002305325.1| predicted protein [Populus trichocarpa] gi|222848289|gb|EEE85836.1| predicted protein [Populus trichocarpa] Length = 257 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -2 Query: 219 VNDTSVRVFKGYGLTKEADAYLSSHGLKNAIYSVDASEVQDDRFGQLIICPFREP 55 V + SV VFKGYGL KEA YLSSHGL NA YS+ A +VQ+D FG+L+ CPF+EP Sbjct: 35 VCNPSVSVFKGYGLPKEAKEYLSSHGLNNAAYSIQAPDVQNDLFGKLLPCPFQEP 89 >gb|AFP44687.1| hypothetical protein, partial [Eragrostis tef] Length = 234 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -2 Query: 219 VNDTSVRVFKGYGLTKEADAYLSSHGLKNAIYSVDASEVQDDRFGQLIICPFREPN 52 V D SV VFKGY L K+ + YL++ GL+NA+YS+DA++ +D+ FG L+ CPF++P+ Sbjct: 118 VCDPSVTVFKGYSLRKDTEEYLAARGLRNALYSIDAADARDELFGDLVPCPFQQPD 173 >ref|XP_002517391.1| nuclease, putative [Ricinus communis] gi|223543402|gb|EEF44933.1| nuclease, putative [Ricinus communis] Length = 255 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -2 Query: 219 VNDTSVRVFKGYGLTKEADAYLSSHGLKNAIYSVDASEVQDDRFGQLIICPFREP 55 V + SV VFKGYGL K+A+ YL SHG+K+A +S+ A++VQ D FG+L+ CPF++P Sbjct: 34 VCNPSVSVFKGYGLAKDAEDYLVSHGIKDAAFSIHATDVQPDLFGKLVPCPFQQP 88 >ref|XP_002440405.1| hypothetical protein SORBIDRAFT_09g000480 [Sorghum bicolor] gi|241945690|gb|EES18835.1| hypothetical protein SORBIDRAFT_09g000480 [Sorghum bicolor] Length = 341 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/56 (50%), Positives = 43/56 (76%) Frame = -2 Query: 219 VNDTSVRVFKGYGLTKEADAYLSSHGLKNAIYSVDASEVQDDRFGQLIICPFREPN 52 V D V V+KGY L KE + YL++ GL+NA+YS+DA++ +D+ FG L+ CPF++P+ Sbjct: 109 VCDPPVTVYKGYSLRKETEEYLAARGLRNAVYSIDAADARDELFGDLVPCPFQQPD 164