BLASTX nr result
ID: Salvia21_contig00038428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00038428 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70940.1| hypothetical protein VITISV_001966 [Vitis vinifera] 58 7e-07 >emb|CAN70940.1| hypothetical protein VITISV_001966 [Vitis vinifera] Length = 231 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 9/66 (13%) Frame = -1 Query: 171 SPLYQIVLPKQA---------TPDMLLYGNKVRSRERAILRKPRATSPMVWFAAILCMIF 19 +P +QI++ KQA TPD G ++ +++ +LR+PR T+PMVW AILC+IF Sbjct: 3 TPPHQIIISKQAMNQHTPAPNTPDP---GTRIVTKQATLLRQPRRTNPMVWCCAILCLIF 59 Query: 18 SLLIIF 1 SLL+IF Sbjct: 60 SLLLIF 65