BLASTX nr result
ID: Salvia21_contig00037612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00037612 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 86 2e-15 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 70 2e-10 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 64 1e-08 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 86.3 bits (212), Expect = 2e-15 Identities = 41/46 (89%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -3 Query: 265 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESGPSLF-FDQR 131 MQLRGPLVGPDRWWYHTLLK TVRDTLASYGS PESGP F FDQR Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQR 46 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 231 GGGITPFSKKPYVTLSRHTAPSRNQDLPFSLTNG 130 GGGITPFSK+PYVTLSRHTAPSRN+DLPF LTNG Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNG 53 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 182 RESVTYGFFEKGVIPPPIRPDERSTELHPYSP 277 RE++TYG FEKGV PPPIRPDERSTELHPYSP Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSP 911