BLASTX nr result
ID: Salvia21_contig00035627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035627 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001145279.1| uncharacterized protein LOC100278574 [Zea ma... 59 5e-07 gb|ADZ55299.1| methyltransferase [Coffea arabica] 57 1e-06 gb|ADY38788.1| methyltransferase [Coffea arabica] 57 1e-06 gb|ABZ89181.1| hypothetical protein 46C02.7 [Coffea canephora] 57 1e-06 ref|NP_175866.2| Methyltransferase family protein [Arabidopsis t... 57 2e-06 >ref|NP_001145279.1| uncharacterized protein LOC100278574 [Zea mays] gi|195654037|gb|ACG46486.1| hypothetical protein [Zea mays] Length = 329 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 293 VELEYCCVKAVNRRNGKVMKRVFVHGKFQK 204 +ELEYCCVK+VNR+NGK M+RV+VHGKFQK Sbjct: 297 LELEYCCVKSVNRKNGKTMRRVWVHGKFQK 326 >gb|ADZ55299.1| methyltransferase [Coffea arabica] Length = 315 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 293 VELEYCCVKAVNRRNGKVMKRVFVHGKFQK 204 +ELEYCCVK+ NRRNGK+M+RV+VHGKFQ+ Sbjct: 282 LELEYCCVKSTNRRNGKLMRRVWVHGKFQR 311 >gb|ADY38788.1| methyltransferase [Coffea arabica] Length = 315 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 293 VELEYCCVKAVNRRNGKVMKRVFVHGKFQK 204 +ELEYCCVK+ NRRNGK+M+RV+VHGKFQ+ Sbjct: 282 LELEYCCVKSTNRRNGKLMRRVWVHGKFQR 311 >gb|ABZ89181.1| hypothetical protein 46C02.7 [Coffea canephora] Length = 315 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 293 VELEYCCVKAVNRRNGKVMKRVFVHGKFQK 204 +ELEYCCVK+ NRRNGK+M+RV+VHGKFQ+ Sbjct: 282 LELEYCCVKSTNRRNGKLMRRVWVHGKFQR 311 >ref|NP_175866.2| Methyltransferase family protein [Arabidopsis thaliana] gi|28393263|gb|AAO42060.1| unknown protein [Arabidopsis thaliana] gi|56550685|gb|AAV97796.1| At1g54650 [Arabidopsis thaliana] gi|332195009|gb|AEE33130.1| Methyltransferase family protein [Arabidopsis thaliana] Length = 299 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 293 VELEYCCVKAVNRRNGKVMKRVFVHGKFQK 204 VELEYCCVKAVNRR GK M RV+VHGKFQK Sbjct: 266 VELEYCCVKAVNRRKGKDMYRVWVHGKFQK 295