BLASTX nr result
ID: Salvia21_contig00030525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00030525 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH58100.1| Dof zinc finger protein [Ipomoea batatas] 62 6e-08 ref|XP_002323863.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_003524761.1| PREDICTED: dof zinc finger protein DOF3.3-li... 60 2e-07 gb|ACU80551.1| Dof3 protein [Jatropha curcas] 59 3e-07 emb|CBI22234.3| unnamed protein product [Vitis vinifera] 59 3e-07 >dbj|BAH58100.1| Dof zinc finger protein [Ipomoea batatas] Length = 497 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/36 (80%), Positives = 30/36 (83%), Gaps = 4/36 (11%) Frame = +3 Query: 3 RYWTAGGTMRNVPVGAGRRKNKN----CRHISAAEA 98 RYWTAGGTMRNVPVGAGRRKNKN CRHI+ EA Sbjct: 182 RYWTAGGTMRNVPVGAGRRKNKNSASHCRHITITEA 217 >ref|XP_002323863.1| predicted protein [Populus trichocarpa] gi|222866865|gb|EEF03996.1| predicted protein [Populus trichocarpa] Length = 506 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +3 Query: 3 RYWTAGGTMRNVPVGAGRRKNKNC----RHISAAEADLGGAFGLSFGPDHEPIK 152 RYWTAGGTMRNVPVGAGRRKNKN RHI+ EA G + G H +K Sbjct: 184 RYWTAGGTMRNVPVGAGRRKNKNSASHYRHITIPEALQNGRADVPNGVHHPSLK 237 >ref|XP_003524761.1| PREDICTED: dof zinc finger protein DOF3.3-like [Glycine max] Length = 473 Score = 60.1 bits (144), Expect = 2e-07 Identities = 40/77 (51%), Positives = 43/77 (55%), Gaps = 17/77 (22%) Frame = +3 Query: 3 RYWTAGGTMRNVPVGAGRRKNKNC----RHISAAEA------------DLGGAFGLSFGP 134 RYWTAGGTMRNVPVGAGRRKNKN RHI+ +EA G LSFG Sbjct: 157 RYWTAGGTMRNVPVGAGRRKNKNSTSHYRHITISEALQAARIDSHLPPLKGNGRVLSFGL 216 Query: 135 D-HEPIKRSDEPIKNGG 182 D H PI S + N G Sbjct: 217 DAHAPICDSMASVNNLG 233 >gb|ACU80551.1| Dof3 protein [Jatropha curcas] Length = 518 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +3 Query: 3 RYWTAGGTMRNVPVGAGRRKNKNC----RHISAAEADLGGAFGLSFGPDHEPIK 152 RYWTAGGTMRNVPVGAGRRKNKN RHI+ +EA + G H +K Sbjct: 183 RYWTAGGTMRNVPVGAGRRKNKNSGSHYRHITVSEALQNVGTDIPNGVHHPALK 236 >emb|CBI22234.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +3 Query: 3 RYWTAGGTMRNVPVGAGRRKNKNC----RHISAAEADLGGAFGLSFGPDHEPIK 152 RYWTAGGTMRNVPVGAGRRKNKN RHI+ +EA + G H +K Sbjct: 178 RYWTAGGTMRNVPVGAGRRKNKNSTSHYRHITVSEALQSARTDVPNGIHHPALK 231