BLASTX nr result
ID: Salvia21_contig00028628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00028628 (738 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW22874.1| putative protein kinase [Solanum lycopersicum] 59 1e-06 ref|XP_003552840.1| PREDICTED: putative serine/threonine-protein... 57 4e-06 >gb|AAW22874.1| putative protein kinase [Solanum lycopersicum] Length = 586 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/52 (53%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -3 Query: 538 GSATTICTITAQPPVQQIQCWRNGLLLP-PILPNTSFDAVAGGRDTLCGVRS 386 GS+ TIC I A P+Q IQCW++ +P PI PN SFD +AGG D VRS Sbjct: 37 GSSATICGIIANQPIQTIQCWKDNQSIPTPISPNVSFDFIAGGFDGFTAVRS 88 >ref|XP_003552840.1| PREDICTED: putative serine/threonine-protein kinase-like protein CCR3-like [Glycine max] Length = 809 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/56 (41%), Positives = 40/56 (71%) Frame = -3 Query: 544 LGGSATTICTITAQPPVQQIQCWRNGLLLPPILPNTSFDAVAGGRDTLCGVRSTSS 377 L S++T+C + A ++I+C+R G ++P I PN SF +++GGR+ CG+RS++S Sbjct: 40 LSDSSSTVCAVVASESTRRIECYRQGQVVP-IAPNVSFSSISGGRNYFCGIRSSNS 94