BLASTX nr result
ID: Salvia21_contig00028315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00028315 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533037.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002533037.1| conserved hypothetical protein [Ricinus communis] gi|223527175|gb|EEF29345.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 54.7 bits (130), Expect = 8e-06 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 24/123 (19%) Frame = -3 Query: 466 RDDADHSGAISSIALLQERFRQLQRMKELRQERELVRTSLSESKISRPP-------PRPH 308 R + D + SSIALLQERFRQL+R KE+RQ+REL+R SE++ +PP P H Sbjct: 3 RQNCDPTSIHSSIALLQERFRQLERAKEMRQQRELLRL-FSEAEQVKPPKAFEQSRPFFH 61 Query: 307 CQLALSL---LPDS----------HA----NRAPSDLAKPYHSPTQSPHFNLHTCDTDID 179 +L L L L DS HA N P+ + S H + ++D+D Sbjct: 62 SELVLPLGQPLQDSLYLQPNMQNRHAELQINETPNSV--DLWSKNTVMHITNNFDESDVD 119 Query: 178 TSL 170 TSL Sbjct: 120 TSL 122