BLASTX nr result
ID: Salvia21_contig00028304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00028304 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272829.2| PREDICTED: uncharacterized protein LOC100253... 67 2e-09 emb|CBI37639.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002521724.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 emb|CAN73445.1| hypothetical protein VITISV_016790 [Vitis vinifera] 64 2e-08 ref|XP_003516521.1| PREDICTED: uncharacterized protein LOC100788... 61 8e-08 >ref|XP_002272829.2| PREDICTED: uncharacterized protein LOC100253902 [Vitis vinifera] Length = 1218 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -2 Query: 168 MRSIERLPETTRSSVRSGVVICDLTRIVEELVFNSLDAGATEXXXXXXXXXSYLKV 1 MRSI+ LPE SSVRSG+++ DLTR+VEEL++NSLDAGAT+ Y+KV Sbjct: 1 MRSIKPLPEAVHSSVRSGIILFDLTRVVEELIYNSLDAGATKVSVSVSVGTCYIKV 56 >emb|CBI37639.3| unnamed protein product [Vitis vinifera] Length = 1230 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -2 Query: 168 MRSIERLPETTRSSVRSGVVICDLTRIVEELVFNSLDAGATEXXXXXXXXXSYLKV 1 MRSI+ LPE SSVRSG+++ DLTR+VEEL++NSLDAGAT+ Y+KV Sbjct: 1 MRSIKPLPEAVHSSVRSGIILFDLTRVVEELIYNSLDAGATKVSVSVSVGTCYIKV 56 >ref|XP_002521724.1| conserved hypothetical protein [Ricinus communis] gi|223539115|gb|EEF40711.1| conserved hypothetical protein [Ricinus communis] Length = 1137 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = -2 Query: 168 MRSIERLPETTRSSVRSGVVICDLTRIVEELVFNSLDAGATEXXXXXXXXXSYLKV 1 M +I+RLPE+ R+S+RSG+++ DLTR+VEELVFNSLDAGA++ Y+KV Sbjct: 1 MGTIKRLPESVRNSMRSGIILFDLTRVVEELVFNSLDAGASKVWVYVGAGTCYVKV 56 >emb|CAN73445.1| hypothetical protein VITISV_016790 [Vitis vinifera] Length = 825 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 168 MRSIERLPETTRSSVRSGVVICDLTRIVEELVFNSLDAGATE 43 MRSI+ LPE SSVRSG+++ DLTR+VEEL++NSLDAGAT+ Sbjct: 1 MRSIKPLPEAVHSSVRSGIILFDLTRVVEELIYNSLDAGATK 42 >ref|XP_003516521.1| PREDICTED: uncharacterized protein LOC100788019 [Glycine max] Length = 1208 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = -2 Query: 168 MRSIERLPETTRSSVRSGVVICDLTRIVEELVFNSLDAGATEXXXXXXXXXSYLKV 1 M SI+ LPE RSS+RSG+ + D TR+VEELVFNSLDA AT+ YLKV Sbjct: 1 MASIKPLPEAVRSSLRSGIFLFDFTRVVEELVFNSLDARATKVSVFVSTRSCYLKV 56