BLASTX nr result
ID: Salvia21_contig00027480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00027480 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY61018.1| zinc finger-homeodomain protein 1 [Welwitschia mi... 66 3e-09 ref|XP_002966118.1| hypothetical protein SELMODRAFT_85536 [Selag... 66 3e-09 ref|XP_002994344.1| hypothetical protein SELMODRAFT_236945 [Sela... 66 3e-09 ref|XP_004143449.1| PREDICTED: ZF-HD homeobox protein At4g24660-... 64 1e-08 emb|CAC34447.1| ZF-HD homeobox protein [Flaveria bidentis] 64 1e-08 >gb|ABY61018.1| zinc finger-homeodomain protein 1 [Welwitschia mirabilis] Length = 316 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 9 VQQFCNELGIKRHVLKVWMHNNKHTLGKKT 98 VQQFCNE+G+KRHVLKVWMHNNKHTLGKK+ Sbjct: 287 VQQFCNEVGVKRHVLKVWMHNNKHTLGKKS 316 >ref|XP_002966118.1| hypothetical protein SELMODRAFT_85536 [Selaginella moellendorffii] gi|300165538|gb|EFJ32145.1| hypothetical protein SELMODRAFT_85536 [Selaginella moellendorffii] Length = 170 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 9 VQQFCNELGIKRHVLKVWMHNNKHTLGKK 95 VQQFCNE+G+KRHVLKVWMHNNKHTLGKK Sbjct: 141 VQQFCNEVGVKRHVLKVWMHNNKHTLGKK 169 >ref|XP_002994344.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii] gi|300137756|gb|EFJ04587.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii] Length = 161 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 9 VQQFCNELGIKRHVLKVWMHNNKHTLGKK 95 VQQFCNE+G+KRHVLKVWMHNNKHTLGKK Sbjct: 132 VQQFCNEVGVKRHVLKVWMHNNKHTLGKK 160 >ref|XP_004143449.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus] gi|449499790|ref|XP_004160918.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus] Length = 248 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 6 LVQQFCNELGIKRHVLKVWMHNNKHTLGKK 95 +VQQFCN+ G+KRHVLKVWMHNNKHTLGKK Sbjct: 218 VVQQFCNDTGVKRHVLKVWMHNNKHTLGKK 247 >emb|CAC34447.1| ZF-HD homeobox protein [Flaveria bidentis] Length = 237 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 9 VQQFCNELGIKRHVLKVWMHNNKHTLGKK 95 VQQFCNE G+KRHVLKVWMHNNKHT+GKK Sbjct: 208 VQQFCNETGVKRHVLKVWMHNNKHTIGKK 236