BLASTX nr result
ID: Salvia21_contig00026836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026836 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524992.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_002266629.1| PREDICTED: uncharacterized protein LOC100243... 62 9e-08 emb|CBI30282.3| unnamed protein product [Vitis vinifera] 61 1e-07 emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] 61 1e-07 ref|XP_002528726.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 >ref|XP_002524992.1| conserved hypothetical protein [Ricinus communis] gi|223535736|gb|EEF37399.1| conserved hypothetical protein [Ricinus communis] Length = 68 Score = 64.3 bits (155), Expect = 1e-08 Identities = 38/68 (55%), Positives = 45/68 (66%), Gaps = 5/68 (7%) Frame = +3 Query: 330 MEKHNSELYLENYQMIRENEKLRNKVEQLTLENQALLSELKQKLLQVNAL-----QLKTS 494 MEK NS+LYL+N MI++NE LR K +QL ENQALLSELKQKL + + L S Sbjct: 1 MEKVNSKLYLQNCYMIQQNEMLRKKAQQLNRENQALLSELKQKLSKSKSTPNDNPDLNLS 60 Query: 495 STSATAHK 518 STS T K Sbjct: 61 STSTTNPK 68 >ref|XP_002266629.1| PREDICTED: uncharacterized protein LOC100243056 [Vitis vinifera] gi|296087972|emb|CBI35255.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 61.6 bits (148), Expect = 9e-08 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = +3 Query: 330 MEKHNSELYLENYQMIRENEKLRNKVEQLTLENQALLSELKQKLLQVNALQLKTSSTS 503 MEK NSELYL+N +I+ENE+LR K +QL ENQALL+E+K+KL KTSS+S Sbjct: 1 MEKLNSELYLQNCYIIQENERLRKKAQQLNQENQALLAEMKEKL-------PKTSSSS 51 >emb|CBI30282.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 61.2 bits (147), Expect = 1e-07 Identities = 37/77 (48%), Positives = 50/77 (64%), Gaps = 11/77 (14%) Frame = +3 Query: 330 MEKHNSELYLENYQMIRENEKLRNKVEQLTLENQALLSELKQKLLQVNA----------L 479 ME+ NS+LYL+N +I+ENE+LR K + L ENQALLSELKQKL + N+ L Sbjct: 1 MERLNSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLSKANSKASAANTIPDL 60 Query: 480 QLKTS-STSATAHKRPP 527 L +S ST++ A+ P Sbjct: 61 NLSSSASTTSAANSTDP 77 >emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] Length = 114 Score = 61.2 bits (147), Expect = 1e-07 Identities = 37/77 (48%), Positives = 50/77 (64%), Gaps = 11/77 (14%) Frame = +3 Query: 330 MEKHNSELYLENYQMIRENEKLRNKVEQLTLENQALLSELKQKLLQVNA----------L 479 ME+ NS+LYL+N +I+ENE+LR K + L ENQALLSELKQKL + N+ L Sbjct: 38 MERLNSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLSKANSKASAANTIPDL 97 Query: 480 QLKTS-STSATAHKRPP 527 L +S ST++ A+ P Sbjct: 98 NLSSSASTTSAANSTDP 114 >ref|XP_002528726.1| conserved hypothetical protein [Ricinus communis] gi|223531820|gb|EEF33638.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +3 Query: 330 MEKHNSELYLENYQMIRENEKLRNKVEQLTLENQALLSELKQKLLQVNALQLKTSST 500 ME+ NS+LYL+N +++ENE+LR K + L ENQALLSELKQKL + N+ +++T Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLTKTNSKANASNNT 57