BLASTX nr result
ID: Salvia21_contig00024723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00024723 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881563.1| proton-dependent oligopeptide transport fami... 65 4e-09 ref|NP_181345.1| proton-dependent oligopeptide transport-like pr... 65 7e-09 >ref|XP_002881563.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297327402|gb|EFH57822.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 521 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/90 (36%), Positives = 54/90 (60%) Frame = +2 Query: 110 ISALLWADILVLYALFEMQDYLTEVWGLSFTHAAGILNIWNGISLVLQPLFLFAVGTFLG 289 +S L WA + + L+ + YLT L FT AA I+N++ G+S + F V F+G Sbjct: 1 MSVLSWAFTVAWFTLWMLMLYLTNEMKLKFTDAAAIVNVFAGVSAIGHLSMQFLVDAFIG 60 Query: 290 NFGMLVISSSSYTLGIWFLFMSAPPVLAGS 379 +F ML +S+ +++ G FL +SA P+L+G+ Sbjct: 61 HFWMLCLSTLAFSFGFGFLAISASPILSGN 90 >ref|NP_181345.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] gi|75223187|sp|O80436.1|PTR29_ARATH RecName: Full=Putative peptide/nitrate transporter At2g38100 gi|3335358|gb|AAC27159.1| putative peptide/amino acid transporter [Arabidopsis thaliana] gi|330254395|gb|AEC09489.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] Length = 521 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/90 (36%), Positives = 54/90 (60%) Frame = +2 Query: 110 ISALLWADILVLYALFEMQDYLTEVWGLSFTHAAGILNIWNGISLVLQPLFLFAVGTFLG 289 +S L WA + + L+ + YLT L FT AA I+N++ G+S + F V F+G Sbjct: 1 MSVLSWAFTVAWFTLWMLMLYLTNEMKLKFTDAAAIVNVFAGVSAIGHLGMQFLVDAFIG 60 Query: 290 NFGMLVISSSSYTLGIWFLFMSAPPVLAGS 379 +F ML +S+ +++ G FL +SA P+L+G+ Sbjct: 61 HFWMLCLSTLAFSFGFGFLAISASPILSGN 90