BLASTX nr result
ID: Salvia21_contig00022557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00022557 (593 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518272.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 emb|CBI15832.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_002518272.1| conserved hypothetical protein [Ricinus communis] gi|223542492|gb|EEF44032.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 170 MEFAASSKPLKPPANISEIVSKFAKVCKFRSIGVFYTSENVDQSH 36 ME A S KP KP NISE+VSKFAK+CK RSIGVF ++EN +Q H Sbjct: 1 MEHATSIKPSKPSPNISEMVSKFAKICKLRSIGVF-SNENPNQQH 44 >emb|CBI15832.3| unnamed protein product [Vitis vinifera] Length = 432 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -1 Query: 182 DNQGMEFAASSKPLKPPANISEIVSKFAKVCKFRSIGVFYTSEN 51 D +GM+ + +KP K +NI+EIVS+FA+VC+FRS+GVF +SEN Sbjct: 30 DFEGMDCGSVTKPSKSSSNITEIVSRFARVCRFRSVGVFSSSEN 73