BLASTX nr result
ID: Salvia21_contig00021167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021167 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267777.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_004161848.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004137635.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|AEN99837.1| chlororespiratory reduction 4, partial [Lobularia... 55 8e-06 >ref|XP_002267777.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Vitis vinifera] gi|296087996|emb|CBI35279.3| unnamed protein product [Vitis vinifera] Length = 598 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -2 Query: 368 STYVLMSNTFADFEDWGSARTLREWLENRDIKKMPGTSWLEIS 240 STYV++SN FAD +W +LRE +E RD+KKMPG+SW++++ Sbjct: 554 STYVVLSNMFADGRNWKGVGSLRELMETRDVKKMPGSSWIQLN 596 >ref|XP_004161848.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Length = 769 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 371 PSTYVLMSNTFADFEDWGSARTLREWLENRDIKKMPGTSWL 249 PSTY+L+SN FA ++W S LRE +E RD+KK+PG+SW+ Sbjct: 721 PSTYILLSNMFAGGDNWDSVGILRELMETRDVKKVPGSSWM 761 >ref|XP_004137635.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Length = 769 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 371 PSTYVLMSNTFADFEDWGSARTLREWLENRDIKKMPGTSWL 249 PSTY+L+SN FA ++W S LRE +E RD+KK+PG+SW+ Sbjct: 721 PSTYILLSNMFAGGDNWDSVGILRELMETRDVKKVPGSSWM 761 >gb|AEN99837.1| chlororespiratory reduction 4, partial [Lobularia maritima] Length = 570 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/45 (48%), Positives = 32/45 (71%) Frame = -2 Query: 371 PSTYVLMSNTFADFEDWGSARTLREWLENRDIKKMPGTSWLEISG 237 PS+YVL+SN +A FE W R +R ++ R I+K+PG SW+E+ G Sbjct: 518 PSSYVLLSNMYASFEMWEDVRRVRTMMKERKIEKVPGCSWIELDG 562