BLASTX nr result
ID: Salvia21_contig00021017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021017 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533808.1| conserved hypothetical protein [Ricinus comm... 137 2e-30 ref|XP_003538324.1| PREDICTED: 28S ribosomal protein S29, mitoch... 134 2e-29 ref|XP_003551194.1| PREDICTED: uncharacterized protein LOC100786... 132 4e-29 ref|XP_003599292.1| 28S ribosomal protein S29 [Medicago truncatu... 128 9e-28 gb|AAF99846.1|AC051629_13 Unknown protein [Arabidopsis thaliana] 124 1e-26 >ref|XP_002533808.1| conserved hypothetical protein [Ricinus communis] gi|223526262|gb|EEF28577.1| conserved hypothetical protein [Ricinus communis] Length = 465 Score = 137 bits (344), Expect = 2e-30 Identities = 62/77 (80%), Positives = 71/77 (92%) Frame = +3 Query: 3 SHSTAVGKLRQDLPDVPTDARIFLPRYNLDEAATVCHYYLRQRLAKYDAFSEENWKKIFY 182 SHSTAVGKLR+DLPDVP DAR+ LPRYNLDEAATVCHYYLRQRL + +AFSEENWKK+++ Sbjct: 389 SHSTAVGKLRKDLPDVPVDARVDLPRYNLDEAATVCHYYLRQRLIRREAFSEENWKKVYF 448 Query: 183 LSHGNGTEMRYLVPFMR 233 LS+GNG EMR+LVP MR Sbjct: 449 LSNGNGAEMRWLVPLMR 465 >ref|XP_003538324.1| PREDICTED: 28S ribosomal protein S29, mitochondrial-like [Glycine max] Length = 436 Score = 134 bits (336), Expect = 2e-29 Identities = 61/77 (79%), Positives = 70/77 (90%) Frame = +3 Query: 3 SHSTAVGKLRQDLPDVPTDARIFLPRYNLDEAATVCHYYLRQRLAKYDAFSEENWKKIFY 182 SHSTAVGKLR+DLPDVP DAR+ PRY+LDEA TVCHYYLRQRL + +AFSEENWKKI++ Sbjct: 360 SHSTAVGKLRKDLPDVPVDARVMFPRYSLDEAETVCHYYLRQRLIRREAFSEENWKKIYF 419 Query: 183 LSHGNGTEMRYLVPFMR 233 LS+GNGTE+R LVPFMR Sbjct: 420 LSNGNGTEIRGLVPFMR 436 >ref|XP_003551194.1| PREDICTED: uncharacterized protein LOC100786442 [Glycine max] Length = 437 Score = 132 bits (333), Expect = 4e-29 Identities = 60/77 (77%), Positives = 70/77 (90%) Frame = +3 Query: 3 SHSTAVGKLRQDLPDVPTDARIFLPRYNLDEAATVCHYYLRQRLAKYDAFSEENWKKIFY 182 SHSTAVGKLR+DLPDVP D+R+ PRY+LDEA TVCHYYLRQRL + +AFSEENWKKI++ Sbjct: 361 SHSTAVGKLRKDLPDVPVDSRVMFPRYSLDEAETVCHYYLRQRLIRREAFSEENWKKIYF 420 Query: 183 LSHGNGTEMRYLVPFMR 233 LS+GNGTE+R LVPFMR Sbjct: 421 LSNGNGTEIRGLVPFMR 437 >ref|XP_003599292.1| 28S ribosomal protein S29 [Medicago truncatula] gi|355488340|gb|AES69543.1| 28S ribosomal protein S29 [Medicago truncatula] Length = 446 Score = 128 bits (321), Expect = 9e-28 Identities = 58/77 (75%), Positives = 68/77 (88%) Frame = +3 Query: 3 SHSTAVGKLRQDLPDVPTDARIFLPRYNLDEAATVCHYYLRQRLAKYDAFSEENWKKIFY 182 SHSTAVGKLR+DLPDVP DAR PRY+L+EA TVCHYYLRQRL + +AF+E+NWKKI++ Sbjct: 370 SHSTAVGKLRKDLPDVPVDARAMFPRYSLEEAETVCHYYLRQRLIRREAFTEDNWKKIYF 429 Query: 183 LSHGNGTEMRYLVPFMR 233 L +GNGTEMR LVPFMR Sbjct: 430 LCNGNGTEMRGLVPFMR 446 >gb|AAF99846.1|AC051629_13 Unknown protein [Arabidopsis thaliana] Length = 451 Score = 124 bits (311), Expect = 1e-26 Identities = 56/77 (72%), Positives = 66/77 (85%) Frame = +3 Query: 3 SHSTAVGKLRQDLPDVPTDARIFLPRYNLDEAATVCHYYLRQRLAKYDAFSEENWKKIFY 182 SHSTAVGKLR+DLPDVP DAR PRY+LDEA VC+YYLRQRL + + F+EENWKKI+Y Sbjct: 375 SHSTAVGKLRKDLPDVPVDARQQFPRYSLDEAEAVCYYYLRQRLVRREVFNEENWKKIYY 434 Query: 183 LSHGNGTEMRYLVPFMR 233 L++GNG EMR+L PFMR Sbjct: 435 LANGNGAEMRWLAPFMR 451