BLASTX nr result
ID: Salvia21_contig00018829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00018829 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated... 104 7e-21 ref|XP_002511641.1| structural molecule, putative [Ricinus commu... 103 1e-20 ref|XP_002274362.2| PREDICTED: probable plastid-lipid-associated... 103 2e-20 emb|CBI16618.3| unnamed protein product [Vitis vinifera] 103 2e-20 ref|XP_002326822.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 >ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cucumis sativus] Length = 213 Score = 104 bits (260), Expect = 7e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +2 Query: 2 FTSAVLRGKGWEFPLPPFGQGWFESLYIDDEIRVVKDIRKDYLVVERAPYSWKE 163 FTSAVLRGK WE PLPPFGQGWF+++Y+DDEIRVVKDIR DYL+VERAPYSW E Sbjct: 160 FTSAVLRGKNWEIPLPPFGQGWFDTVYLDDEIRVVKDIRGDYLIVERAPYSWTE 213 >ref|XP_002511641.1| structural molecule, putative [Ricinus communis] gi|223548821|gb|EEF50310.1| structural molecule, putative [Ricinus communis] Length = 217 Score = 103 bits (258), Expect = 1e-20 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +2 Query: 2 FTSAVLRGKGWEFPLPPFGQGWFESLYIDDEIRVVKDIRKDYLVVERAPYSWKE 163 FTSAVLRGK WE PLPPFGQGWFES+Y+DD+IRV KDIR DYLVV+RAPY+W+E Sbjct: 164 FTSAVLRGKSWEIPLPPFGQGWFESVYVDDDIRVAKDIRGDYLVVDRAPYAWRE 217 >ref|XP_002274362.2| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Vitis vinifera] Length = 219 Score = 103 bits (256), Expect = 2e-20 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +2 Query: 2 FTSAVLRGKGWEFPLPPFGQGWFESLYIDDEIRVVKDIRKDYLVVERAPYSWKE 163 FTSAVLRGK WEFPLPPFGQGWFES+Y+D RV KDIR+DYLVVERAPY WKE Sbjct: 166 FTSAVLRGKDWEFPLPPFGQGWFESVYLDSGFRVAKDIREDYLVVERAPYEWKE 219 >emb|CBI16618.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 103 bits (256), Expect = 2e-20 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +2 Query: 2 FTSAVLRGKGWEFPLPPFGQGWFESLYIDDEIRVVKDIRKDYLVVERAPYSWKE 163 FTSAVLRGK WEFPLPPFGQGWFES+Y+D RV KDIR+DYLVVERAPY WKE Sbjct: 87 FTSAVLRGKDWEFPLPPFGQGWFESVYLDSGFRVAKDIREDYLVVERAPYEWKE 140 >ref|XP_002326822.1| predicted protein [Populus trichocarpa] gi|222835137|gb|EEE73572.1| predicted protein [Populus trichocarpa] Length = 171 Score = 102 bits (255), Expect = 3e-20 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 FTSAVLRGKGWEFPLPPFGQGWFESLYIDDEIRVVKDIRKDYLVVERAPYSW 157 FTSAVLRGK WE PLPPFGQGWFESLYID+EIRVVKDIR DYLVV++APY+W Sbjct: 120 FTSAVLRGKNWEIPLPPFGQGWFESLYIDEEIRVVKDIRGDYLVVDKAPYAW 171