BLASTX nr result
ID: Salvia21_contig00018633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00018633 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC99303.1| alpha-L-arabinofuranosidase [Pyrus pyrifolia] 55 5e-06 >dbj|BAC99303.1| alpha-L-arabinofuranosidase [Pyrus pyrifolia] Length = 674 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/68 (44%), Positives = 38/68 (55%) Frame = -1 Query: 291 VKVVNFGGNTVNLDLFVEGLDINSIEAAGXXXXXXXXTNVKDENCFNEXXXXXXXXXALK 112 +KVVN G +TVNL +FV+GLD NSI +G N DEN FNE L+ Sbjct: 574 IKVVNLGTDTVNLKVFVDGLDPNSISLSGSTKTVLTSNNQMDENSFNEPTKVIPKQSLLE 633 Query: 111 NASNKMRV 88 +AS +M V Sbjct: 634 SASEEMEV 641