BLASTX nr result
ID: Salvia21_contig00018441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00018441 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598950.1| Activating signal cointegrator 1 complex sub... 57 2e-06 ref|XP_002514664.1| activating signal cointegrator 1 complex sub... 55 6e-06 >ref|XP_003598950.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] gi|355487998|gb|AES69201.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] Length = 1465 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 8/66 (12%) Frame = -3 Query: 233 QNLNRCSSAAAAGEPELAHKIIYRWNEASFEVRQLYKTFVAAVA--------SEEFQQVV 78 QN N + A++ E ELA KI+Y W EAS EVRQ YK F+ AV SE+F +V Sbjct: 30 QNRNTRNVASSLDESELARKIVYGWEEASSEVRQAYKQFIGAVVGLVDGEMRSEDFHEVA 89 Query: 77 VQAYRL 60 + YRL Sbjct: 90 LTVYRL 95 >ref|XP_002514664.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] gi|223546268|gb|EEF47770.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] Length = 2100 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 8/60 (13%) Frame = -3 Query: 215 SSAAAAGEPELAHKIIYRWNEASFEVRQLYKTFVAAVA--------SEEFQQVVVQAYRL 60 ++A + E ELA KI+ RW EAS EVRQ YK F+ AV SEEF++V + AYRL Sbjct: 38 NNANSLNESELARKIVDRWEEASTEVRQAYKQFIGAVVELVDGEVPSEEFREVALTAYRL 97