BLASTX nr result
ID: Salvia21_contig00017895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017895 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266061.1| PREDICTED: uncharacterized membrane protein ... 57 2e-06 >ref|XP_002266061.1| PREDICTED: uncharacterized membrane protein At4g06598 [Vitis vinifera] gi|147788552|emb|CAN61016.1| hypothetical protein VITISV_021778 [Vitis vinifera] gi|297739555|emb|CBI29737.3| unnamed protein product [Vitis vinifera] Length = 374 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/64 (51%), Positives = 38/64 (59%), Gaps = 6/64 (9%) Frame = +2 Query: 59 HRNIPSEG-VIEEQPSWLDDLLNDSGALFHKGHRRSASDSCAYQGAE-----AFTLDDES 220 H+ SEG +IEEQPSWLDDLLN+ +GHRRS+SDS AY A T DE Sbjct: 60 HQRTSSEGFLIEEQPSWLDDLLNEPETPVRRGHRRSSSDSFAYMDATNVSNIDHTAQDEL 119 Query: 221 DFVN 232 F N Sbjct: 120 KFRN 123