BLASTX nr result
ID: Salvia21_contig00015781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015781 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32677.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloro... 76 3e-12 ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloro... 71 8e-11 ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloro... 71 8e-11 ref|XP_002323003.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 >emb|CBI32677.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 76.3 bits (186), Expect = 3e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -2 Query: 289 VDLPGGPLDIEWRESDNHIYMTGPAELVFYGSVPL 185 VDLPGGPLDIEWRE DNH+YMTGPAE+VFYGSVPL Sbjct: 273 VDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 307 >ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 76.3 bits (186), Expect = 3e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -2 Query: 289 VDLPGGPLDIEWRESDNHIYMTGPAELVFYGSVPL 185 VDLPGGPLDIEWRE DNH+YMTGPAE+VFYGSVPL Sbjct: 336 VDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 370 >ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like, partial [Cucumis sativus] Length = 172 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 289 VDLPGGPLDIEWRESDNHIYMTGPAELVFYGSVPL 185 VDLPGGPL IEW E DNH+YMTGPAE+VFYGSVPL Sbjct: 137 VDLPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 171 >ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Cucumis sativus] Length = 364 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 289 VDLPGGPLDIEWRESDNHIYMTGPAELVFYGSVPL 185 VDLPGGPL IEW E DNH+YMTGPAE+VFYGSVPL Sbjct: 329 VDLPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 363 >ref|XP_002323003.1| predicted protein [Populus trichocarpa] gi|222867633|gb|EEF04764.1| predicted protein [Populus trichocarpa] Length = 281 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 289 VDLPGGPLDIEWRESDNHIYMTGPAELVFYGSVPL 185 VDLPGGPL+IEWRE DNH+YMTGPAE+VF GSVPL Sbjct: 247 VDLPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 281